KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1150Help
Entry
NMA1150           CDS       T00031                                 

Definition
(GenBank) putative dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00020  Citrate cycle (TCA cycle)
nma00310  Lysine degradation
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01120  Microbial metabolism in diverse environments
nma01130  Biosynthesis of antibiotics
nma01200  Carbon metabolism
Module
nma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA1150
  Amino acid metabolism
   00310 Lysine degradation
    NMA1150
Enzymes [BR:nma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMA1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAM08356
UniProt: A0A0U1RIJ7
Position
1100403..1101614
Genome map
AA seq 403 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMP
AAAKLAAESGVDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMS
RLRARVAERLLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAA
VAALKKYPVVNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDY
AKKAKDGKIAIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQV
VVRPMMYLALSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgccgct
cctgccgaagctgccccggccgccgctcctgctgctgcacaaaacaacgccgctatgcct
gccgccgccaaactggctgcagagagcggtgttgacgtgaacgcattgcaaggttccggc
cgtgacggtcgcgtattgaaagaagacgtacaaaatgccgcagccaaacctgccgcagcc
gctgctcctgccgttgcacttcctgccggcgcacgtcctgaagaacgcgtaccgatgagc
cgcctgcgtgcccgtgttgcagaacgcctcttggcttctcaacaagaaaacgccattctg
actacattcaacgaagtcaacatgaaaccaatcatggacttgcgtgcgaagtacaaagaa
aaattcgagaaagaacacggcgtgaaactgggctttatgtccttcttcgttaaagccgct
gttgcagccctgaaaaaatacccggttgtgaatgcttctgttgacggcaaagacattgtg
taccacggctacttcgacatcggtatcgcgattggcagcccacgcggtttggttgtgcca
atcctgcgcgatgccgaccaaatgagcattgccgacatcgaacaagcaattgttgattac
gcgaaaaaagccaaagacggcaaaatcgctatcgaagatctgaccggcggtacattcagt
attaccaacggcggtactttcggttctatgatgtccaccccgatcatcaatccgcctcaa
tctgcgattttgggtatgcacgccactaaagagcgcgctgtggttgaaaacggccaagtt
gttgtccgtccaatgatgtatctggctctgtcttacgaccaccgtatcattgacggccgc
gaagctgtattgaccttggtagccattaaagacgcgttggaagacccagcccgcctgttg
ttggatctgtaa

DBGET integrated database retrieval system