KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1719
Entry
NMA1719           CDS       T00031                                 
Name
(GenBank) putative disulphide isomerase
  KO
K04084  thioredoxin:protein disulfide reductase [EC:1.8.4.16]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Brite
KEGG Orthology (KO) [BR:nma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nma03110]
    NMA1719
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.16  thioredoxin:protein disulfide reductase
     NMA1719
Chaperones and folding catalysts [BR:nma03110]
 Protein folding catalysts
  Protein disulfide isomerase
   NMA1719
SSDB
Motif
Pfam: DsbC DsbD DsbD_2 Thioredoxin Thioredoxin_7 Thioredoxin_2 DUF4131
Other DBs
NCBI-ProteinID: CAM08848
UniProt: Q9JTL9
Position
complement(1650068..1651909)
AA seq 613 aa
MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRF
RIADGYYMYQAKIVGKTDPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVG
EPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDEPASAKDRFLQPSSQNGSGAL
PPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
RAFVLSVVYVQGLSLTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFN
IQLPNAVQSYFQNQSSRLSGGKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVL
GGLALYTLALGTGVPLIAIGTFGGHILPRAGDWMNAVKYAFGFILLAVAVYLATPHLPYY
LVVALYTLLMLVPACMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHH
FLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADWCISCKEMAAY
TLNQPEVHQAVDMERFFQIDVTANTPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFV
KADKFIEWYEQNR
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgcagacaaattatttgtctgaaacggattcgattatgaaaaaactgatttgcctgttc
gccgtatttttgatgttgtgcggacgagctttcgcgctggatgcgaacgatctgctgccg
ccggaaaaggcattcgtgccggagcttgccgttgccgacgacggtgtgaacgtccgtttc
aggattgccgacggatactatatgtatcaggcgaaaatcgtcggcaagaccgatccggcg
gatttgttgggacagccttctttcagcaagggcgaagagaaggaagacgagtttttcggc
aggcagacggtttaccatcacgaagcgcaggttgcctttccttatgcaaaggctgtcggc
gaaccgtataaattggttttgacctatcagggctgtgccgaagccggcgtgtgctatccg
cccgtggataccgagtttgatatttccggcaacggcacttaccatccgcaaaccgacgaa
ccggcatccgccaaagaccgctttttgcagccttcctctcaaaacggcagcggggcgctg
ccgcccccgaagggggatgagggcggcgacagccgtttcaagctgtcttgggatacgctc
aacgccaatcttttggcgttttttctcgccggtttgggtctgagttttaccgcctgtatg
tatcccctgttgccgattgtttccagtattgtggtcggtgacaaaaaggcgggcaaggcg
cgggcgtttgtgctgtccgtcgtttatgttcagggtttgtctctgacttatacgctggtc
ggcattgttgccggactgacgggcgcgctgctgaccgtatggttgcagcaggcttgggtg
gtgttggcggcatcggctttaatggtcgtcttggcactgtctatgttcgggctgttcaac
atccagcttcccaacgccgtgcagtcgtattttcagaatcaaagcagcaggctttcaggc
ggtaaaatcgtttccgtctttattatgggcatattgtccgcgctgattgtcgggccgtgt
gtcgccccgccgctggcatttgctttgggctacatcggtcagacgggcgatgcggtttta
ggcggtttggcactttacactttggcgttgggcactggcgttccgctgattgccatcggc
acgttcggcgggcatatcctgcctagggcaggcgattggatgaatgccgtcaaatacgct
ttcggctttatcctgcttgccgtcgccgtttacctcgccacgccgcacttgccctattat
ctcgtcgtcgcgctgtacacgctgctgatgctggttcctgcctgtatgctgctggtcaac
ggacgcaggcagaaacgccgtccgaaagctgtggcattcgcattgggcggcatattgctg
ataggcggcgcgtggttcggctggcagggcgcaaacggcaaaacgaccgcgctgcaccat
ttcctgaccctcaatccaccagccgaagcaggcaaatcttcggaacacggcaaaatgttt
gccgatactgccgcgctgaaggcagcgatggatacggcgttgaaagaacatcccgacaaa
cccgtcgttttggatttttatgccgactggtgtatttcctgcaaagaaatggcggcatac
acgctcaatcagccggaagtgcatcaggcggttgatatggaacgctttttccaaatcgac
gtaaccgccaacacgcctgaacatcaggcgttgttgaaagaatacggtctgttcgggccg
ccgggcgtgtttgtcgtccgctccgacggcagccgcagcgagccgctgctgggttttgtc
aaagcagacaagtttatcgagtggtatgaacaaaaccgctga

DBGET integrated database retrieval system