KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1748Help
Entry
NMA1748           CDS       T00031                                 

Definition
(GenBank) glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00970  Aminoacyl-tRNA biosynthesis
nma01100  Metabolic pathways
Module
nma_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMA1748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nma01007]
    NMA1748
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nma03016]
    NMA1748
Enzymes [BR:nma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     NMA1748
Amino acid related enzymes [BR:nma01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NMA1748
Transfer RNA biogenesis [BR:nma03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMA1748
 Prokaryotic Type
   Other AARSs
    NMA1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Motif
Other DBs
NCBI-ProteinID: CAM08876
UniProt: P57000
Position
complement(1691533..1693254)
Genome map
AA seq 573 aa AA seqDB search
MPSEAICSKKTMLNKDQFADNHFIRTIIEDDLKSGKHEAVQTRFPPEPNGYLHIGHAKSI
CLNFGLAYIYDGLCNLRFDDTNPEKENDEYVNAIKEDVEWLGFHWAGEPRFASNYFDQLY
DYAVGLIKDGKAYVDDLTPEEMREYRGTLTEAGKNSPYRDRSVEENLDLFTRMKNGEFPD
GSKTLRLKIDMASGNINMRDPVIYRIRRAHHHNTGDKWCIYPMYDYTHCISDAIEGITHS
LCTLEFEAHRPLYDWVLDNIHAPHATRPRQYEFSRLELLYTITSKRKLNQLVVEKHVSGW
DDPRMPTISGMRRRGYTPEGLRLFAKRAGISKSENIVDMSVLEGAIREELENSAPRLMAV
LNPLKVTLTNFEAGRTQSRRAAFHPNHEEMGEREVPISQTIYIEADDFAENPPKGFKRLI
PGGEVRLRHGYVIKCDEVVKDEAGNVVELKCSIDHDTLGKNPEGRKVKGVIHWVSAEHAA
EIKVRLYDRLFTIERPDAVRGEDGEYLPFTDFLNPESVKEITAYAEPAAKDLPAESRWQF
ERIGYFVTDRKDHGKDTPVFNRTVTLKDSWQPK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccatctgttcaaagaaaactatgctcaataaagaccaatttgcggac
aaccattttatccgcaccatcatcgaagacgacctcaaaagcggcaaacacgaagccgtc
caaacccgttttccgccggagcccaacggttacctgcacatcggacacgccaaatccatc
tgcctgaacttcggtttggcgtatatttacgacggcttgtgcaacctgcgttttgacgat
accaaccccgaaaaagaaaacgacgaatacgtcaacgccatcaaagaagatgtcgagtgg
ctcggtttccattgggcgggcgagccgcgtttcgcttccaactatttcgaccagctttat
gactacgccgtcggtttgattaaagacggcaaagcgtatgtcgatgatttgacgcccgaa
gaaatgcgcgaataccgcggtacgctgaccgaagcgggtaaaaacagcccttaccgcgac
cgcagcgtcgaagaaaacctcgacctgttcacacgcatgaaaaacggcgagttccccgac
ggcagcaaaaccctgcgcctgaaaatcgacatggcatcgggcaacatcaatatgcgcgac
cccgtcatctaccgcatccgccgcgcccatcaccacaacaccggcgacaaatggtgtatc
tacccgatgtacgactacacgcattgcatctccgatgccatcgaaggcatcacgcattcc
ttgtgtacgctcgaatttgaagcacaccgtccgctgtacgactgggtgttggataacatc
cacgcgccgcatgccacccgtccgcgccaatacgagttttcccgtttggagcttttgtac
accattacctccaaacggaaattgaatcagttggttgtggaaaaacacgtttccggctgg
gacgatccgcgtatgccgactatttccggtatgcgccgacgcggctacacgcccgaaggc
ctgcgtctgtttgccaaacgcgccggtatttccaaatctgaaaacatcgtcgatatgagc
gtgttggaaggcgcgattcgcgaagagttggaaaattccgccccacgcctgatggcggtg
ttgaacccgctcaaagtgaccctgaccaactttgaagccggcagaacccaaagccgccgt
gccgcgttccatccgaaccacgaggaaatgggcgagcgcgaagtacctatttcacaaacc
atctatattgaagccgacgactttgccgaaaatccgcccaaaggcttcaaacgcctgatt
cccggcggcgaagtacgcttgcgccacggctatgtcatcaagtgcgatgaagtcgtcaaa
gacgaagcaggcaatgtggttgaactcaaatgcagcatcgaccacgacaccttgggcaaa
aatccagaaggccgtaaagttaaaggcgtgattcattgggtttccgccgaacacgccgcc
gaaatcaaagtccgtctgtacgaccgcctctttaccatcgagcgtcccgatgccgtgcgc
ggcgaagacggcgaatacctgccgttcaccgatttcctcaatccggaatccgtcaaggaa
atcaccgcctacgccgaacctgccgccaaagatttgccggcagaaagccgttggcagttc
gagcgtatcggctacttcgtaaccgaccgtaaagaccacggcaaagacacgccggtgttt
aaccgcacggtcacgctgaaagattcttggcagcctaagtaa

DBGET integrated database retrieval system