KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1820Help
Entry
NMA1820           CDS       T00031                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00480  Glutathione metabolism
nma00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMA1820
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMA1820
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMA1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAM08941
UniProt: P0A0T4
Position
complement(1767753..1768286)
Genome map
AA seq 177 aa AA seqDB search
MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILD
FPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNH
LFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttgtcaggc
tatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgaccccgcaa
tacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagattttggat
tttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcccaagtg
tgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaatggagca
aataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggcaatcat
ctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaaggcgac
atcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgagcgtttt
gcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system