KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA2099Help
Entry
NMA2099           CDS       T00031                                 

Definition
(GenBank) aldose 1-epimerase (mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00010  Glycolysis / Gluconeogenesis
nma00052  Galactose metabolism
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01120  Microbial metabolism in diverse environments
nma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMA2099
   00052 Galactose metabolism
    NMA2099
Enzymes [BR:nma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NMA2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAM09200
UniProt: A0A0U1RKB6
Position
complement(2051961..2052971)
Genome map
AA seq 336 aa AA seqDB search
MSDTPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVRENLVVSFDD
AASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHGLAVTRFNAV
AADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDDRLTVTYRATALGDTVFDPTLHIYW
RLDAGLHDAVLHIPQGGHIPADAEKLPVSTVSDDLEVFDFSRPKPLDAAVAALRRETGRA
GFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATE
AQTLPDSLHWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccgcgatttcggcctgatcgacgggcgtgccgtaaccggc
tatgtgctgtccaaccggcgtggtacgcgtgtctgcgtgctggacttgggcgggattgtg
caggaattttccgttttggcagacggcgtgcgcgaaaacctcgtggtgtcgttcgacgat
gcggcttcctatgcggacaatccgtttcagattaacaagcagatagggcgcgtggccgga
cgcatccgcggtgcggcgttcgacatcaacggcaggacttaccgcgtggaggccaacgaa
ggcaggaacgcgctgcacggcggttcgcacgggctggccgttacccgtttcaacgcggtg
gcggcagacggccgttcggtggtgctgcgcagccgcctgcaacagtcggccgacggttat
cccaacgatttggatttggatatttcctaccgcttggacgaggacgaccggcttaccgtt
acctatcgcgccaccgcgctcggcgacacggtgttcgacccgacgctgcacatttactgg
cggctggacgcgggcctgcacgatgcggttctgcatattccgcagggcggacatattccg
gccgatgccgaaaaactgcccgtctcaacggtttcagacgacctcgaagtatttgatttc
agccggcccaagccgctggatgccgccgttgccgccctgcgccgcgaaacgggtcgggcc
ggttttgacgacgcttaccgcgtgccgtccgatataggccgtcccgccgctgtgttgcaa
gccggacgccgccgtcgtatcagcatatacagcgaccgcaacggcttggtcatctttacc
gccgccccgcaggatttcgcgcggcacgatgcgggcgtttacgacgcgctggcgaccgag
gcgcagacgctgcccgacagcctgcattggcccgagttcggcaatatccgtctgaacaag
ggtgataccagggaggcgacgattgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system