KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0932Help
Entry
NMC0932           CDS       T00458                                 

Gene name
sucB
Definition
(GenBank) putative dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00020  Citrate cycle (TCA cycle)
nmc00310  Lysine degradation
nmc01100  Metabolic pathways
nmc01110  Biosynthesis of secondary metabolites
nmc01120  Microbial metabolism in diverse environments
nmc01130  Biosynthesis of antibiotics
nmc01200  Carbon metabolism
Module
nmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMC0932 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMC0932 (sucB)
Enzymes [BR:nmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMC0932 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAM10209
UniProt: A1KTM3
Position
932586..933827
Genome map
AA seq 413 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAATAAAEAPAAATAAAEAPAAAPAEAAPAAAP
AAAQNNAAMPAAAKLAAESGVDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAG
ARPEERVPMSRLRARVAERLLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKL
GFMSFFVKAAVAALKKYPVVNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSI
ADIEQAIVDYAKKAKDGKIAIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATK
ERAVVENGQVVVRPMMYLALSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgctgct
actgccgctgctgaagcacctgccgccgctcctgccgaagctgccccggccgccgctcct
gctgctgcacaaaacaacgccgctatgcctgccgccgccaaactggctgcagagagcggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgcagccaaacctgccgcagccgctgctcctgccgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgcagccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacattgtgtaccacggctacttcgacatcggtatcgcg
attggcagcccacgcggtttggttgtgccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaatccgcctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system