KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC1579Help
Entry
NMC1579           CDS       T00458                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00230  Purine metabolism
nmc01100  Metabolic pathways
Module
nmc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMC1579 (gmk)
Enzymes [BR:nmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NMC1579 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 cobW AAA_22 AAA_25 MobB CbiA AAA_18 MMR_HSR1 AAA_28 ArgK Thymidylate_kin NTPase_1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAM10771
UniProt: A1KV70
Position
complement(1609377..1609994)
Genome map
AA seq 205 aa AA seqDB search
MSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEVNGVHYHFVSK
EEFESLIAQEAFLEYADVFGNYYGTSAEGVNALAAAGYDVILEIDVQGAAQVRNALPEAV
GIFILPPSFDVLAARLNGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDDLARAEEDL
RHIVNACRLKRSRQLGFIADLLENS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatcgaaaaggcaacatctttatcatttcggccgcttccggcacgggcaaa
accacgctggtgtcgcggctgttggcaaaccataacggtttgcgcgtttccgtatcgcac
acgacgcgtccgccgcgtgaaggcgaagtaaacggcgtacattatcattttgtttctaaa
gaagagtttgagtcgcttatcgcgcaggaagcttttttggaatacgcagacgtgttcggc
aactattacggcacaagcgcggagggcgtgaatgctttggcggcggcaggctatgacgta
attttggaaatcgacgttcagggcgcggcgcaggttcgcaacgcgctgccggaagccgtc
ggcatctttatcctgccgccgtctttcgatgtgcttgctgcacgtctgaacggacgcggg
acggacagtcgggaagttatccaaaggaggctgtcgaaggcaaggcatgaaatcgaacag
tccgtattgttcgattttgtcgtggtcaatgatgacttggcgcgggcggaggaggatttg
cgccatattgtgaatgcctgccgtctgaaaaggtcgcggcaactgggatttattgcagat
ttgttggaaaattcctaa

DBGET integrated database retrieval system