KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC2048
Entry
NMC2048           CDS       T00458                                 

Definition
(GenBank) putative permease
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-ProteinID: CAM11203
UniProt: A1KWE6
Position
2102430..2103653
AA seq 407 aa
MSGNASSPSSSAAIGLIWFGAAVSIAEISTGTLLAPLGWQRGLAALLLGHAVGGALFFAA
AYIGALTGRSSMESVRLSFGKRGSVLFSVANMLQLAGWTAVMIYAGATVSSALGKVLWDG
ESFVWWALANGALIVLWLVFGARKTGGLKTVSMLLMLLAVLWLSAEVFSTAGSTAAQVSD
GMSFGTAVELSAVMPLSWLPLAADYTRQARRPFAATLTATLAYTLTGCWMYALGLAAALF
TGETDVAKILLGAGLGAAGILAVVLSTVTTTFLDAYSAGVSANNISAKLSETPIAVAVAV
VGTLLAVLLPVTEYENFLLLIGSVFAPMAAVLIADFFVLKRREEIEGFDFAGLVLWLAGF
ILYRFLLSSGWESSIGLTAPVMSAVAIATVSVRLFFKKTQSLQRNPS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtcgggcaatgcctcctctccttcatcttccgccgccatcgggctgatttggttcggc
gcggcggtctcgattgccgaaatcagcacgggtacgctgcttgcgcctttgggctggcaa
cgcggtctggcggctctacttttgggtcatgccgtcggcggcgcgctgttttttgcggcg
gcgtatatcggcgcactgaccggacgcagctcgatggaaagcgtgcgcctgtcgttcggc
aaacgcggttcagtgctgttttccgtggcgaatatgctgcaactggccggctggacggcg
gtgatgatttacgccggcgcaacggtcagctccgctttgggcaaagtgttgtgggacggc
gaatcttttgtctggtgggcattggcaaacggcgcgctgattgtgctgtggctggttttc
ggcgcacgcaaaacaggcgggctgaaaaccgtttcgatgctgctgatgctgttggcggtt
ctgtggctgagtgccgaagtcttttccacggcaggcagcaccgccgcacaggtttcagac
ggcatgagtttcggaacggcagtcgaattgtccgccgtcatgccgctttcctggctgccg
ctggccgccgactacacacgccaagcacgccgcccgtttgcggcaaccctgacggcaacg
ctcgcctatacgctgacgggctgctggatgtatgccttgggtttggcagcggcgttgttc
accggagaaaccgacgtggcaaaaatcctgctgggcgcaggtttgggtgcggcaggcatt
ttggcggtcgtcctgtcgaccgttaccaccacttttctcgatgcctactccgccggcgta
agtgccaacaatatttccgccaaactttcggaaacacccatcgccgttgccgtcgccgtt
gtcggcacactgcttgccgtcctcctgcccgttaccgaatatgaaaacttcctgctgctt
atcggctcggtatttgcgccgatggcggcggttttgattgccgactttttcgtcttgaaa
cggcgtgaggagattgaaggctttgactttgccggactggttctgtggctggcgggcttc
atcctctaccgcttcctgctctcgtccggctgggaaagcagcatcggtctgaccgccccc
gtaatgtctgccgttgccattgccaccgtatcggtacgccttttctttaaaaaaacccaa
tctttacaaaggaacccgtcatga

DBGET integrated database retrieval system