KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0003Help
Entry
NMBG2136_0003     CDS       T01929                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00860  Porphyrin and chlorophyll metabolism
nmd00970  Aminoacyl-tRNA biosynthesis
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01120  Microbial metabolism in diverse environments
Module
nmd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBG2136_0003 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMBG2136_0003 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmd01007]
    NMBG2136_0003 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmd03016]
    NMBG2136_0003 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:nmd02048]
    NMBG2136_0003 (gltX)
Enzymes [BR:nmd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     NMBG2136_0003 (gltX)
Amino acid related enzymes [BR:nmd01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NMBG2136_0003 (gltX)
Transfer RNA biogenesis [BR:nmd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMBG2136_0003 (gltX)
 Prokaryotic Type
   Other AARSs
    NMBG2136_0003 (gltX)
Prokaryotic defense system [BR:nmd02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    NMBG2136_0003 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADY92765
Position
complement(918..2312)
Genome map
AA seq 464 aa AA seqDB search
MTVKTRFAPSPTGYLHIGGVRTALFSWAFARHHKGEFLLRIEDTDLARSTAESVNIILDG
MKWVGLDYDNAGNVVYQTRRFDRYKEVIAELLEKGDAYYCYCSKEELEAMREKAEKEGTA
TYDRRWRPEAGKTLPEIPAGVQPVVRFKTPLDGVTKWADLVKGEISIPNEALDDLIIARA
DGTPTYNFCVVVDDYDMGVTHVIRGDDHVNNTPKQINILKAIGATLPEYGHLPMILNEQG
KKISKRSGDTVAITDFGAMGILPEAMLNYLARLGWAHGDDEFFTMEQFIEWFDLKDVSPS
PSRMDLKKLYWINGEHIKITPNGKLAELVKPRLALRDIHETEKPALEDVLALVKDRAQDL
NTLADECLYFYVKQTPTEADVQKHWDDEAAARMLRFAERLEGLEDWNAEAIHDLFKPFCD
EEGIKMGKLGMPLRLAVCGTAKTPSVDAVLALIGKEEVLKRIRA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaaacccgtttcgcccccagcccaaccggctacctgcacatcggcggcgta
cgcaccgccctgttttcttgggcgtttgcccgccatcataaaggcgaattcttattgcgc
atcgaagacaccgacttggcgcgctctactgccgaatccgtcaacatcatcctcgacggc
atgaaatgggtcggactcgattacgacaacgccggcaacgtcgtgtaccaaacccgccgt
ttcgaccgctataaagaagtcatcgccgaacttttagaaaaaggcgatgcctactactgc
tattgcagcaaagaagagttggaagccatgcgcgagaaagccgaaaaagaaggcacggcg
acttacgaccgccgctggcggccggaagcaggcaaaaccctgcccgaaatccctgccggc
gtgcaacccgtcgtccgcttcaaaacgcctttggacggcgtaaccaagtgggcggacctg
gtcaaaggcgaaatctccatccccaacgaagcactcgacgacctgattatcgcccgcgcc
gacggcacgccgacctacaacttctgcgttgtcgtggacgactacgacatgggcgttacc
cacgttatccggggcgacgaccatgtgaacaacaccccgaaacaaatcaacatcttaaaa
gccatcggcgctaccctgcctgaatacggccacctgccgatgattcttaacgaacaaggc
aaaaaaatctccaaacgcagcggcgataccgttgccattaccgatttcggcgcgatgggc
atcctgcccgaagccatgctcaactatctggcacgtttgggctgggcgcacggcgacgat
gagttcttcacgatggaacaatttatcgaatggtttgatttgaaagacgtttctccatct
ccaagccgcatggatttgaagaaactctactggatcaacggcgaacacatcaaaatcacg
cccaacggcaaactcgccgaactcgtcaaaccgcgtctcgctctgcgcgatatccatgaa
actgaaaaacctgcattggaagacgtgttggcactggtcaaagaccgcgcccaagacctg
aacacacttgccgacgagtgcctctacttctacgtcaaacaaacgcctactgaagcggac
gtgcagaaacactgggacgatgaagccgccgcccgtatgctgcgctttgccgaacgcctc
gaagggctggaagactggaatgccgaagccatccacgacctcttcaaacccttctgcgac
gaagaaggcattaaaatgggcaaactcggcatgcccctgcgccttgccgtctgcggtacg
gcgaaaacccccagcgtcgatgctgtgttggcattaatcggcaaagaagaagtgttgaaa
cgcatccgcgcttaa

DBGET integrated database retrieval system