KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0143Help
Entry
NMBG2136_0143     CDS       T01929                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMBG2136_0143 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nmd03011]
    NMBG2136_0143 (rplV)
Ribosome [BR:nmd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NMBG2136_0143 (rplV)
  Bacteria
    NMBG2136_0143 (rplV)
  Archaea
    NMBG2136_0143 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADY92890
Position
146516..146845
Genome map
AA seq 109 aa AA seqDB search
MRVNAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEH
NNGADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaatgcacaacataaaaatgcccgtatctctgctcaaaaggctcgtttggta
gctgatttgattcgtggtaaagacgttgcccaagctttgaatattttggctttcagtcct
aaaaaaggtgccgagctgattaaaaaagtattggagtcagctattgctaatgccgagcac
aataacggtgcggacattgatgaactgaaagtggtaactatctttgttgacaaaggccca
agcttgaaacgttttcaagctcgcgccaaaggtcgcggtaaccgcatcgaaaaacaaact
tgtcatatcaatgtgacagtgggtaactaa

DBGET integrated database retrieval system