KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0261Help
Entry
NMBG2136_0261     CDS       T01929                                 

Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00900  Terpenoid backbone biosynthesis
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMBG2136_0261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nmd01006]
    NMBG2136_0261
Enzymes [BR:nmd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NMBG2136_0261
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NMBG2136_0261
Prenyltransferases [BR:nmd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMBG2136_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF3326
Motif
Other DBs
NCBI-ProteinID: ADY93001
Position
complement(262403..263299)
Genome map
AA seq 298 aa AA seqDB search
MNPTNDLKAWQQRAQAQTELLLERFLPSENEIPHTLHEAMRYAALDGGKRLRPMLVLAAS
ELGEAVHEAVEQAMAAIEMIHVYSLVHDDMPAMDNDSLRRGKPTCHIKYGEANALLTGDA
LQTQAFDVLSRPTELPAARQLAMLSVLAKAGGSRGMAGGQAIDLANVGKQMVQADLEQMH
SLKTGALIRAAVLLGATACPDLSDAELSVLDAYAAKLGLAFQVIDDVLDCEADTATLGKT
AGKDADNDKPTYVKLMGLEAARSYAHKLVAEAVALLEPFGDKALRLRQLAEFAVARKY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgaatccgacgaatgatttgaaagcgtggcaacagagggcgcaggcacagacagagctg
ctgctggaacgctttttgccgtctgaaaacgaaatcccgcacacgctgcacgaagcgatg
cgctatgcggctttggacggcggcaagcgtctgcgtccgatgctggttctggcagcttcg
gaattaggcgaagccgtgcatgaagcagtagaacaggcaatggcggcaatcgaaatgatc
cacgtctattctttggttcacgacgatatgccggcgatggacaacgacagcctgcgccgg
ggcaaaccgacctgccacatcaaatatggcgaagcaaacgcactgctgaccggcgatgct
ttgcaaacccaagccttcgacgtgttaagtcgtccgacagaactgcccgccgcacgccag
ttggcaatgttgtcggtgttggcgaaagcgggcggcagcaggggtatggcgggcggtcag
gcaatcgatttggcgaatgtcggcaaacaaatggttcaagccgatttggaacagatgcac
agcctgaaaacgggtgcgctaatccgtgcggcggttttattgggggcgacggcgtgtcct
gatctgtcagatgcggaactttccgtattggacgcttacgcggcaaaactggggctggcg
ttccaagtcattgacgatgtgttggattgtgaagcggacacggcgactttgggcaaaacg
gcgggcaaagacgcagacaacgacaagccgacttatgtgaaactgatgggcttggaagcg
gcgcgctcatacgcacacaaactggttgccgaagcggtcgcgctgctcgaacccttcggc
gacaaagccctgcgcctgcggcagttggcagaatttgcagtcgcccgcaaatattaa

DBGET integrated database retrieval system