KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0576Help
Entry
NMBG2136_0576     CDS       T01929                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00040  Pentose and glucuronate interconversions
nmd00052  Galactose metabolism
nmd00500  Starch and sucrose metabolism
nmd00520  Amino sugar and nucleotide sugar metabolism
nmd01100  Metabolic pathways
nmd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NMBG2136_0576 (galU)
   00052 Galactose metabolism
    NMBG2136_0576 (galU)
   00500 Starch and sucrose metabolism
    NMBG2136_0576 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBG2136_0576 (galU)
Enzymes [BR:nmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NMBG2136_0576 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADY93306
Position
complement(618512..619381)
Genome map
AA seq 289 aa AA seqDB search
MKPIKKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYERSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgataaaaaaagccgtcttccccgtcgcagggatgggaacacgcttcctgccc
gccaccaaggccagcccgaaagaaatgctgcccatcgtcgacaaaccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaacttctggaacacgtccgcaacatcctgccaccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgtgcc
gccatcggcgacgaacccttcgccgtgattttggctgacgatttaatcgatgccccaaaa
ggcgcgctcaaacaaatggtcgaagtgtacgaacgcagcggcaacagcattttgggcgta
gaaactgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgtcgtcggacgctacatccttaccccgcgcattttcgacctcttaaccaatctt
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactgggc
tacctcgaagccaccgtcgcctacggcctgaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgtaccgaataa

DBGET integrated database retrieval system