KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0728Help
Entry
NMBG2136_0728     CDS       T01929                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00860  Porphyrin and chlorophyll metabolism
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01120  Microbial metabolism in diverse environments
Module
nmd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBG2136_0728
Enzymes [BR:nmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMBG2136_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADY93453
Position
754597..755337
Genome map
AA seq 246 aa AA seqDB search
MLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVFWVSPTAV
ETAVPYLNLSDGIKMHISVGQGSRRALERCLGRTVIAPEDGNDSEAVLRLTVWNSLPEGA
RVLFVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYITSTELVR
LLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSISVSDGMV
FPGTSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgtccgaccgtcgggcagggcgaaggacgatgtggaaacctgccgtcgtgcc
ggatggcaggcggaagtgttgagcccgattgaaatcgaagcagatgctgccggactggaa
cttttgtccgaacaatatgcccgtgcggatgccgtgttttgggtcagtccgaccgccgtt
gaaaccgccgtcccgtaccttaacctttcagacggcataaagatgcacatttccgtaggg
cagggcagccgccgtgcattggaacgctgtttgggcagaacggtcatcgcgcccgaagac
ggcaacgacagcgaggcggttttgcgcctgacggtttggaacagtctgcccgaaggtgcg
cgcgtattgtttgtgcgcggacacggcgggcgggattttctgatgaatgccttgcaggag
aaaggttttcggacggaggtggcagaagtctatttcagacggcataaacctttgaacttt
caaaatttccaaaccgaaaatattgccgccgcctatattacgtccacagaactcgtgcgc
ttgctgttcggacagcttccgccgcaattttcccgattcttcaaatccttgctatacttt
acccatcatccgcgcattgcggaggcattgaagcgcgaaggcgtgtgttcggtcgaaacc
gtccctacgctggaagccgcgctttcccattcttccatttccgtttcagacggcatggtc
tttcccggaacctcaaattaa

DBGET integrated database retrieval system