KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0809Help
Entry
NMBG2136_0809     CDS       T01929                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00900  Terpenoid backbone biosynthesis
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMBG2136_0809 (ispE)
Enzymes [BR:nmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NMBG2136_0809 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADY93531
Position
832090..832935
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKSRDDGKIILHN
PVDGMPQEADLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQRQLIDSGAALGADVPFFIFGKNAFARGIGDRLDEMDIPKQWYVIVKPPVHVST
AKIFTHEGLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRNSAYNIYRQVSDLYEAYLAEGLSKHPWLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaatcgagggatgacggcaaaatcatcctgcacaat
ccggttgatggaatgccgcaggaagcggatttaagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgcggtctgacgcagcggcagctcattgattcgggcgcggctctgggggcggac
gtaccgttttttattttcggcaaaaatgcgtttgcgcggggtataggcgacaggctggac
gaaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaggcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaacctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgagttgtcccgatatggatttgccttaatgacaggttct
ggtgcgtgtgtattcacggcgtgtcaagataggaatagcgcatacaatatataccgacaa
gtttcagatttgtacgaggcatatttggcagagggtctttcaaaacatccttggttgtcc
gtataa

DBGET integrated database retrieval system