KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0921Help
Entry
NMBG2136_0921     CDS       T01929                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00020  Citrate cycle (TCA cycle)
nmd00190  Oxidative phosphorylation
nmd00650  Butanoate metabolism
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01120  Microbial metabolism in diverse environments
nmd01130  Biosynthesis of antibiotics
nmd01200  Carbon metabolism
Module
nmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBG2136_0921 (sdhD)
   00650 Butanoate metabolism
    NMBG2136_0921 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBG2136_0921 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ADY93638
Position
933980..934306
Genome map
AA seq 108 aa AA seqDB search
MTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFTQVSFI
AVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtgcccattacggtttgcgcgattgggcgatgcaacgtgcgactgcggttatt
atgttgatttataccgttgcacttttagtggttctattttccctgcctaaagaatattcg
gcatggcaggcattttttagtcaaacttgggtaaaagtatttacccaagtgagcttcatc
gccgtattcttgcacgcttgggtgggtatccgcgatttgtggatggactatatcaaaccc
ttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctggtcggctgcttggtg
tattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system