KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0010Help
Entry
NMB0010           CDS       T00027                                 

Gene name
pgk
Definition
(RefSeq) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0010 (pgk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     NMB0010 (pgk)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB0010 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-GeneID: 902112
NCBI-ProteinID: NP_273076
UniProt: Q9K1R0
Position
complement(6281..7492)
Genome map
AA seq 403 aa AA seqDB search
MAFLKLTEQNVQGKTVLIRADMNVPFKDGKISDDTRIRASLASIKYCVDNGASVIVMTHL
GRPTEGEFHPEDDVAPVAAHLGSLLGKDVKVLNDWRENKPALNAGDVVMLQNVRINKGEK
KNDLELGKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVACAGVLMAGELDALGKALK
QPARPMVAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTFLLAEGKAIGKSLAEHDLV
EESKKIMAKMAAKGGSVPLPTDVVVAKAFAADAEAVVKDIAADAEAVVKDIADVAEDEMI
LDIGPKSAAALADLLKAAGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKAFSIAGGGDT
LAAIAKFGVTEQIGYISTGGGAFLEFLEGKELPAVAALEKRGA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcatttttaaaactgaccgaacaaaacgtgcagggcaaaaccgtcctcatccgcgcc
gatatgaacgtaccgttcaaagacggcaaaatcagcgacgacacccgtatccgcgcctcg
ctcgcgtccattaaatactgcgtggacaacggtgcgtccgttatcgtgatgacccatctc
ggccgcccgaccgaaggcgagttccaccccgaagacgatgtcgcccccgttgccgcgcac
ttgggcagcctgttgggcaaagacgtgaaagtattgaacgactggcgtgaaaacaaaccc
gccctgaacgcgggcgatgtcgtcatgctgcaaaacgtgcgcatcaacaaaggcgagaag
aaaaacgatttggaactgggtaaagcctacgcttctttgtgcgacgtgttcgtcaatgac
gcgttcggaaccgcccaccgcgcccaagcctcgaccgaagccgtcgcccaagccgcgccc
gttgcctgcgccggcgtattgatggcgggcgaactcgacgctttgggcaaagccttgaaa
cagcccgcgcgcccgatggttgccatcgttgccggcagcaaagtgtccaccaagctgacc
atcctcgaatcgctggcggacaaagtcgaccaactcatcgtcggcggcggtatcgcaaac
accttcctgttggcggaaggcaaagccatcggcaaatctttggcggaacacgatttggtg
gaagaatccaaaaaaattatggcgaaaatggcggcaaaaggcggttctgtgccgctgccg
accgatgtcgtcgttgccaaagcctttgccgccgatgcggaagctgtggtgaaagacatt
gccgccgatgcggaagctgtggtgaaagacattgccgacgttgccgaagacgagatgatt
ttggacatcggtccgaaatccgctgccgcgcttgccgatttgcttaaagccgccggtacg
gtcgtttggaacgggccggtcggcgtgttcgagtttgaccaattcgcaggcggtacgaaa
gcccttgccgaagccattgcccaaagcaaagcgttctcgattgcgggcggcggcgacacg
ctggcggcgattgccaaattcggcgttaccgaacaaatcggctacatctccaccggcggc
ggcgcgttccttgagttcttggaaggcaaagagctgcctgccgtagccgctttggaaaaa
cgcggcgcgtaa

DBGET integrated database retrieval system