KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0011Help
Entry
NMB0011           CDS       T00027                                 

Gene name
murA
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0011 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0011 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0011 (murA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NMB0011 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   NMB0011 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 902113
NCBI-ProteinID: NP_273077
UniProt: Q9K1Q9
Position
complement(7573..8826)
Genome map
AA seq 417 aa AA seqDB search
MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVPMLADVKTTQKLLQGM
GARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLARFGEAQVSLPGGCAIG
SRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTVGGTENLLMAATLAEGTT
VLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGVDELQGCEHSVVPDRIEAGTFLC
AVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIAIDMRQRPKAVDIRTVVHPG
FPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRMGANITTEGNTAFVQGVEQLS
GAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYENIEKKLGSVGAKIERVSG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactgaaaatctccgcaaacggcccgctcaacggggaaataacggtctcgggc
gcgaaaaacgcggcattgccgctgatgtgcgcgggtttgctgacatcgggtacgttgcgc
ctgaaaaacgtccctatgctggcagatgtgaaaaccacgcaaaagctgcttcaggggatg
ggcgcgcgcgtcctgaccgacaatatcagcgaatttgaaatcaacggcggtacggtaaac
aatacctgcgccccttacgagttggtccgaacgatgcgcgcttcgattttggtgctgggc
ccgacgctggcgcgtttcggcgaggcgcaagtcagcctgccgggcggctgcgccatcggt
tcgcgccccgtcgatcagcatttgaaaggcttggaagcgatgggtgctgagattgttatc
gaacacggttacgtcaaagccaaaggcaaactcaaaggtacgcgcgtggcgatggatgtc
gttaccgtcggcggcacggaaaacctgctgatggcggcgacgctggcggaaggtacgacg
gttttggaaaactgcgccattgagcctgaagtggtcgatttggcggaatgcctggtcaaa
atgggcgcgaaaatcagcggcatcggtacgtccacaatgattgtggaaggggtggacgag
ctgcaaggctgcgaacacagcgtcgtccccgaccggatcgaggcggggacgttcctgtgc
gcggtggcgataaccggtggcagggtggttttgcggaatgccgcgccgaaaacgatggaa
gtggtgttggacaaactggttgaggcaggtgcggtgattgaggcgggcgacgattggatc
gccatcgatatgcggcagcgtccgaaggcggtggacatccgcacggtcgtccaccccggc
ttccccacggatatgcaggcgcagtttatggcattgaatgccgtggcggagggaagctgc
cgcgtggtggaaacgatttttgaaaaccgctttatgcacgtccccgagttgaaccggatg
ggggcgaacatcacaaccgagggcaatacggcatttgtgcagggtgtggaacagctttcc
ggcgcagtcgtcaaggcgacggatttgcgtgcgtccgccagcctcgttatcgccggtttg
gcggcgcgaggcgaaaccgtggtcgaacagatttaccacttggatcgcggttatgaaaat
attgaaaaaaaactcggcagcgtcggcgcgaaaatcgagcgcgtatccggctga

DBGET integrated database retrieval system