KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0015Help
Entry
NMB0015           CDS       T00027                                 

Gene name
gnd
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme00480  Glutathione metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nme_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0015 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB0015 (gnd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     NMB0015 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     NMB0015 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored TrbH
Motif
Other DBs
NCBI-GeneID: 902118
NCBI-ProteinID: NP_273081
UniProt: Q9K1Q5
Position
complement(12174..13622)
Genome map
AA seq 482 aa AA seqDB search
MNGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTTAKVDEFLNGAAKGTNIIGAYSLQDL
VDKLEKPRKIMMMVRAGSVVDEFIEQLLPLLEEGDILIDGGNANYPDTTRRTHYLAEKGI
LFVGAGVSGGEEGARRGPSIMPGGDKRAWDAVKPIFQAIAAKTSQGEPCCDWVGKDGAGH
FVKMVHNGIEYGDMQLICEAYQFMKDGLGLSYDEMYRVFAEWNKTELDSYLIEITAAILG
YKDEGGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLISEAVFARCVSSFKEQRVQTG
KLFARTVTPVEGGKQEWVEALRQALLASKIISYAQGFMLIREAGESYGWDLDYGNTALLW
REGCIIRSAFLSNIRDAYENNPDLVFLGADPYFKNILENCLPAWRKVVAKAVECGIPMPC
MASAITFLDGYTTERLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNWTGKGGDTASTTY
DI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgatattggtgtaatcggtttggcggttatggggcaaaacctgattttgaat
atgaacgattgcggatttaaggtggttgcctacaaccgcacgactgccaaggtggacgaa
tttttaaacggcgcggcaaaaggaactaatattatcggcgcgtattctttgcaagatttg
gtcgataagctggaaaaaccgcgaaaaattatgatgatggttcgtgccggttcggtggtt
gacgaatttatcgaacaactgcttccgctgttggaagaaggcgacatccttatcgacggc
ggcaatgccaattaccccgacacgacacggcggacacattaccttgctgaaaaagggatt
ttgtttgtcggcgcgggcgtgtccggcggggaagaaggggcgcggcgcgggccgtccatt
atgccgggcggggataagcgcgcttgggatgcggtcaagccgatttttcaggcgattgcc
gccaaaacgtcgcagggcgaaccgtgttgcgactgggtcggcaaagacggtgcggggcat
tttgtcaaaatggtgcataacggcatcgaatatggcgatatgcagttgatttgcgaagcg
taccagttcatgaaagacggcttggggctgtcttacgacgaaatgtaccgcgtgtttgcc
gagtggaacaaaaccgagctggattcttatctgattgaaatcacagcggcaattttgggc
tataaggacgaaggcggcgaaccgctggtcgagaaaatcctcgatacggcagggcaaaaa
ggtacaggcaaatggacgggcatcaatgctttggatttgggtattccgctgacgctgatt
tccgaagccgtattcgcccgctgcgtttcgtcgttcaaagaacagcgcgtgcagaccggc
aaactgttcgcccgaaccgttacgcccgtcgaaggcggcaaacaagaatgggtcgaggcg
ttgagacaggccctgcttgcatctaaaatcatttcctacgcacaaggctttatgctgatc
cgcgaagcgggcgaaagctacggctgggatttggactacggcaacactgcgctgctgtgg
cgcgaggggtgcatcattcgcagcgcattcttaagcaatatccgcgacgcgtatgaaaac
aatcccgatttggtgttcttgggtgcggatccgtatttcaaaaatattttggaaaactgc
ctgccggcgtggcgcaaggtggttgccaaggcggtcgaatgcggcatccctatgccctgc
atggcttcggcgattacgttcttggacggctacacgaccgaacgtctgcctgccaacctc
ttgcaggcacagcgcgactacttcggcgcgcacacttacgagcgcaccgacaaaccgcgc
ggtgagtttttccataccaactggacgggcaagggcggagataccgcttcgacaacctac
gatatttga

DBGET integrated database retrieval system