KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0038Help
Entry
NMB0038           CDS       T00027                                 

Gene name
glmU
Definition
(RefSeq) UDP-N-acetylglucosamine pyrophosphorylase
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0038 (glmU)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     NMB0038 (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     NMB0038 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transf_3 NTP_transferase Hexapep_2 IspD CTP_transf_3 CofC DUF4954
Motif
Other DBs
NCBI-GeneID: 902141
NCBI-ProteinID: NP_273104
UniProt: Q9K1P3
Position
complement(36454..37824)
Genome map
AA seq 456 aa AA seqDB search
MPQNTLNIVILAAGKGTRMYSKMPKVLHRIGGKPMVGRVIDTAAALNPQNICVVIGHGKE
QVLDTVKRDVVWVEQTEQLGTGHAVKTALPHLSAEGRTLVLYGDVPLIDVETLETLLEAA
GNEVGLLTDVPNDPTGLGRIIRDSNGSVTAIVEEKDADAVQKAVKEINTGILVLPNAKLE
NWLNSLSSNNAQGEYYLTDLIAKAVADGIKVHPVQVRASHLAAGVNNKLQLTELERIFQT
EQAQELLKAGVTLRDPARFDLRGRLKHGQDVVIDVNCIFEGDIELGDNVEIGANCVIKNA
KIGANSKIAPFSHLESCEVGENNRIGPYARLRPQARLADDVHVGNFVEIKNAAIGKGTKA
NHLTYIGDAEVGCKTNFGAGTIIANYDGVHKHKTVIGDEVRIGSNCVLVAPVTLGNKVTT
GAGSTITRNVEDNKLALARARQTVIEGWVRPEKDKQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaaacactttaaacatcgtcatcctcgccgccggcaaaggcacgcgcatgtat
tccaaaatgccaaaagtgctgcaccgcatcggcggcaagcccatggtcgggcgcgttatc
gacaccgcagccgcactgaatccgcaaaacatctgcgtcgtcatcggccacggcaaagag
caagtcttggacaccgtcaaacgcgatgtcgtttgggttgaacaaaccgaacagctcggt
accggccacgccgtcaaaaccgccctgccccacctttccgccgaaggccgcacgctggtg
ttgtacggcgacgttcctttaattgacgttgaaaccctcgaaaccctgctcgaagccgca
ggcaacgaagtcgggctgttgaccgacgttcccaacgacccgacaggcttggggcgtatc
atccgcgacagcaacggcagcgtaaccgccatcgtcgaagaaaaagacgccgacgccgtc
caaaaagccgtgaaagaaatcaataccggcatcctcgtcctgcccaacgccaaactcgaa
aactggctgaacagcctttccagcaacaatgcacaaggcgaatactacctgaccgacctc
atcgccaaagccgttgccgacggtattaaagttcatcccgtccaagtgcgcgcctcccac
ctcgccgccggcgtgaacaacaaactccagctcaccgaactcgaacgcatcttccaaacc
gaacaggcgcaagaattgctcaaagcaggcgtaaccctgcgcgatccggcacgtttcgat
ttacgaggccgtctgaaacacgggcaagacgtcgtgattgatgtgaactgtatctttgaa
ggcgacatcgagctcggcgacaacgtcgaaatcggcgcaaactgcgtcatcaaaaacgcc
aaaatcggcgcaaacagcaaaatcgcccccttctcccacctcgaaagctgcgaagtcggc
gaaaacaaccgaatcggcccgtacgcccgcctgcgtccgcaagcccgccttgcagacgac
gtacacgtcggcaacttcgtcgaaatcaaaaacgccgccatcggcaaaggcaccaaagcc
aaccacctcacctacatcggcgacgccgaagtcggctgcaaaaccaacttcggcgccggt
acgattattgccaactacgacggcgtgcacaaacacaaaaccgtcatcggcgacgaagtg
cgcatcggttcaaactgcgtcctagtcgcccccgttaccctcggcaacaaagtaaccaca
ggcgcgggcagcacgattacccgcaatgtcgaagacaacaaactcgccctcgcccgcgcc
cgccaaaccgtcatcgaaggctgggtgcgtcctgaaaaagacaaacaataa

DBGET integrated database retrieval system