KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0055Help
Entry
NMB0055           CDS       T00027                                 

Gene name
proC
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00330  Arginine and proline metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB0055 (proC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     NMB0055 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH Sacchrp_dh_NADP NAD_binding_2 ApbA
Motif
Other DBs
NCBI-GeneID: 902157
NCBI-ProteinID: NP_273120
UniProt: Q9K1N1
Structure
PDB: 

Position
59160..59951
Genome map
AA seq 263 aa AA seqDB search
MNVYFLGGGNMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPELHSDDV
LILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPGKIGLG
VSGMYAEAEVSETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQN
AAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRV
AEAISEGVCACVRRSQEMERQYQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttattttctcggcggcggcaatatggcggctgccgttgcgggcggattggtc
aaacaaggcggttaccgcatctatatagccaatcggggtgcggaaaaacgcgaacgtttg
gaaaaagagttgggggtcgaaacttcggcaaccctgccggagcttcattccgacgatgtt
ttaatccttgccgtcaaaccgcaggatatggaagctgcgtgcaaaaatatccgcaccaac
ggcgcattggtgctttctgtcgcagccggattgtcggtcggtacgctcagccgttacctc
gggggaacacgccgcattgtccgggttatgccgaatacacccggaaaaatcgggctgggc
gtatctggtatgtatgccgaagcggaagtatcggaaacagaccgcaggattgccgatcga
atcatgaaatcagtcggtttgactgtttggttggatgatgaggaaaaaatgcacggcatt
accggcatcagcggcagcggaccggcttatgtgttttatctgctggacgcattgcaaaat
gccgccatccgacaagggtttgatatggcagaagcacgcgcgctcagtctggcaacgttt
aaaggagcggttgcccttgccgagcagacgggtgaagatttcgagaagcttcaaaaaaat
gtaacgtcaaaaggcgggacaacccacgaagccgtggaagctttcaggcggcatcgtgtc
gccgaagccataagcgagggcgtttgtgcctgtgtgcgccgttcgcaggaaatggaacgg
caatatcaataa

DBGET integrated database retrieval system