KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0063Help
Entry
NMB0063           CDS       T00027                                 

Gene name
rfbB-1
Definition
(RefSeq) dTDP-D-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00521  Streptomycin biosynthesis
nme00523  Polyketide sugar unit biosynthesis
nme00525  Acarbose and validamycin biosynthesis
nme01130  Biosynthesis of antibiotics
Module
nme_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMB0063 (rfbB-1)
   01055 Biosynthesis of vancomycin group antibiotics
    NMB0063 (rfbB-1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB0063 (rfbB-1)
   00525 Acarbose and validamycin biosynthesis
    NMB0063 (rfbB-1)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     NMB0063 (rfbB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD NAD_binding_4 adh_short Sacchrp_dh_NADP KR NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 902170
NCBI-ProteinID: NP_273127
UniProt: P55294
Position
complement(71898..72965)
Genome map
AA seq 355 aa AA seqDB search
MRKILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTYAGNLESLTEVADNPRYAFEQVDI
CDRAELDRVFAQYRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMP
SEQHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGL
PTIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVV
TEGVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVR
YAVDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQNVLNGSYRLERLGTGK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatccttgttaccggcggcgcgggctttatcggttctgccgttgtccgtcat
attatccgaaacacccgggacgctgtcgtcaatgtcgataagctgacttatgccggcaat
ttggaatctttgactgaggtagccgataatcctcgctatgcttttgaacaagtggatatt
tgcgaccgcgccgaactcgaccgcgtattcgcgcaataccggcctgatgccgtgatgcac
ttggcggcggaaagccatgtcgaccgctctatcggttcggcaggcgagtttatccaaacc
aatatcgtcggcacattcaatctgcttgaagcagcccgcgcctactggcaacaaatgccg
tctgaacagcacgaagccttccgtttccaccatatttccaccgatgaagtctatggcgat
ttaggcggcacggacgatttgtttaccgaaaccgcgccctacgcgccgtccagcccctac
tctgcctctaaagcgtccagcgaccacctcgtccgcgcgtggttgcgtacttacggcttg
ccgaccattgtaaccaactgctccaacaactacggtccttaccattttccggaaaaactc
attcctttgatgattctgaacgcgcttgacggcaaaccgctgcctgtgtacggcgacggt
atgcaaatccgcgactggctgtttgtcgaagaccacgcgcgcgcactgtatcaggttgtt
accgaaggtgttgtcggcgaaacctacaatatcggcggccacaatgaaaaagccaatatt
gaagtcgtcaaaaccatctgcgccctgctggaagaactcgctcccgaaaaaccggccggt
gtggcgcgttatgaagatttgattactttcgtacaagaccgccccggccatgacgtacgc
tacgccgtcgacgcagccaaaatcaggcgggatttgggctggctgcctttggaaaccttc
gagtccggcctccgcaaaaccgtgcaatggtatctggacaacaaaacctggtggcaaaat
gtattgaacggcagctatcgtttggaacgtttaggtactggaaaatag

DBGET integrated database retrieval system