KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0064Help
Entry
NMB0064           CDS       T00027                                 

Gene name
galE
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00052  Galactose metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NMB0064 (galE)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0064 (galE)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     NMB0064 (galE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NAD_binding_4 NmrA NAD_binding_10 TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 902171
NCBI-ProteinID: NP_273128
UniProt: P56985
Position
complement(73081..74100)
Genome map
AA seq 339 aa AA seqDB search
MKKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQEIPFYQGDI
RDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSI
VFSSSATVYGDPGKVPYTEDMPPGDTTSPYGASKSMVERILTDIQKADPRWSMILLRYFN
PIGAHESGLIGEQPNGIPNNLLPYICQVAAGKLPQLAVFGDDYPTPDGTGMRDYIHVMDL
AEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACF
YADPSYTKAQIGWQTQRDLTQMMEDSWRWVSNNPNGYDD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattctcgttaccggcggcaccggttttatcggctcgcataccgttgtttct
ttgctgaaaagcggccatcaagtcgtgattttggataacctatgcaattccagcatcaat
atcctgccacgcttgaaaacgattaccggccaagagattccgttttatcaaggcgatatc
cgcgatcgtgagattttgcgccgtatttttgcggaaaaccgcattgattcggtgattcat
tttgccggcttgaaagcggtgggtgaaagtgtggccgagccgatgaaatattatgataat
aatgtttccggcagcttggtgttggcggaagaaatggcgcgtgcgggcgtgtttagcatt
gtgttcagttcttcggcgacggtttatggcgatccgggcaaagtgccttataccgaggat
atgccaccgggcgacaccaccagcccttacggcgcatcgaaatcgatggttgagcgcatt
ctcactgacattcaaaaagccgatccgcgctggagcatgattttgttgcgttatttcaat
ccgattggcgcgcatgaaagcggcttgattggcgagcagccaaacggcatcccgaataat
ttgttgccttatatctgccaagtggcggcaggcaaactgccgcaattggcggtatttggc
gatgactaccctacccccgacggcacggggatgcgtgactatattcatgtgatggatttg
gcagaaggccatgtcgcggctatgcaggcaaaaagtaatgtagcaggcacgcatttgctg
aacttaggctccggccgcgcttcttcggtgttggaaatcatccgcgcatttgaagcagct
tcgggtttgacgattccgtatgaagtcaaaccgcgccgtgccggtgatttggcgtgcttc
tatgccgacccttcctatacaaaggcgcaaatcggctggcaaacccagcgtgatttaacc
caaatgatggaagactcatggcgctgggtgagtaataatccgaatggctacgacgattaa

DBGET integrated database retrieval system