KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0068Help
Entry
NMB0068           CDS       T00027                                 

Gene name
siaC
Definition
(RefSeq) polysialic acid capsule biosynthesis protein SiaC
  KO
K01654  N-acetylneuraminate synthase [EC:2.5.1.56]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0068 (siaC)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.56  N-acetylneuraminate synthase
     NMB0068 (siaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NeuB SAF
Motif
Other DBs
NCBI-GeneID: 902174
NCBI-ProteinID: NP_273132
UniProt: Q7DDU0
Structure
PDB: 

Position
complement(77374..78423)
Genome map
AA seq 349 aa AA seqDB search
MQNNNEFKIGNRSVGYNHEPLIICEIGINHEGSLKTAFEMVDAAYNAGAEVVKHQTHIVE
DEMSDEAKQVIPGNADVSIYEIMERCALNEEDEIKLKEYVESKGMIFISTPFSRAAALRL
QRMDIPAYKIGSGECNNYPLIKLVASFGKPIILSTGMNSIESIKKSVEIIREAGVPYALL
HCTNIYPTPYEDVRLGGMNDLSEAFPDAIIGLSDHTLDNYACLGAVALGGSILERHFTDR
MDRPGPDIVCSMNPDTFKELKQGAHALKLARGGKKDTIIAGEKPTKDFAFASVVADKDIK
KGELLSGDNLWVKRPGNGDFSVNEYETLFGKVAACNIRKGAQIKKTDIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaacaacgaatttaaaattggtaatcgttcagtaggttacaaccacgaacca
ttgattatctgtgaaatcggcatcaatcatgaaggctctttaaaaacagcttttgaaatg
gttgatgctgcctataatgcaggcgctgaagttgttaaacatcaaacacacatcgttgaa
gacgaaatgtctgatgaggccaaacaagtcattccaggcaatgcagatgtctctatttat
gaaattatggaacgttgcgccctgaatgaagaagatgagattaaattaaaagaatacgta
gagagtaagggtatgatttttatcagtactcctttctctcgtgcagctgctttacgatta
caacgtatggatattccagcatataaaatcggctctggcgaatgtaataactacccatta
attaaactggtggcctcttttggtaagcctattattctctctaccggcatgaattctatt
gaaagcatcaaaaagtcggtagaaattattcgagaagcaggggtaccttatgctttgctt
cactgtaccaacatctacccaaccccttacgaagatgttcgattgggtggtatgaacgat
ttatctgaagcctttccagacgcaatcattggcctgtctgaccataccttagataactat
gcttgcttaggagcagtagctttaggcggttcgattttagagcgtcactttactgaccgc
atggatcgcccaggtccggatattgtatgctctatgaatccggatacttttaaagagctc
aagcaaggcgctcatgctttaaaattggcacgcggcggcaaaaaagacacgattatcgcg
ggagaaaagccaactaaagatttcgcctttgcatctgtcgtagcagataaagacattaaa
aaaggagaactgttgtccggagataacctatgggttaaacgcccaggcaatggagacttc
agcgtcaacgaatatgaaacattatttggtaaggtcgctgcttgcaatattcgcaaaggt
gctcaaatcaaaaaaactgatattgaataa

DBGET integrated database retrieval system