KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0069Help
Entry
NMB0069           CDS       T00027                                 

Gene name
siaB
Definition
(RefSeq) polysialic acid capsule biosynthesis protein SiaB
  KO
K00983  N-acylneuraminate cytidylyltransferase [EC:2.7.7.43]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0069 (siaB)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.43  N-acylneuraminate cytidylyltransferase
     NMB0069 (siaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 902175
NCBI-ProteinID: NP_273133
UniProt: P0A0Z7
Structure
PDB: 

Position
complement(78424..79110)
Genome map
AA seq 228 aa AA seqDB search
MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEE
AKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFS
LFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYI
NDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaaaatattgcggttatacttgcgcgccaaaactccaaaggattgccatta
aaaaatctccggaaaatgaatggcatatcattacttggtcatacaattaatgctgctata
tcatcaaagtgttttgaccgcataattgtttcgactgatggcgggttaattgcagaagaa
gctaaaaatttcggtgtcgaagtcgtcctacgccctgcagagctggcctccgatacagcc
agctctatttcaggtgtaatacatgctttagaaacaattggcagtaattccggcacagta
accctattacaaccaaccagtccattacgcacaggggctcatattcgtgaagctttttct
ctatttgatgagaaaataaaaggatccgttgtctctgcatgcccaatggagcatcatcca
ctaaaaaccctgcttcaaatcaataatggcgaatatgcccccatgcgccatctaagcgat
ttggagcagcctcgccaacaattacctcaggcatttaggcctaatggtgcaatttacatt
aatgatactgcttcactaattgcaaataattgtttttttatcgccccaaccaaactttat
attatgtctcatcaagactctatcgatattgatactgagcttgatttacaacaggcagaa
aacattcttaatcacaaggaaagctaa

DBGET integrated database retrieval system