KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0070Help
Entry
NMB0070           CDS       T00027                                 

Gene name
synX
Definition
(RefSeq) polysialic acid capsule biosynthesis protein SynX
  KO
K08068  UDP-N-acetylglucosamine 2-epimerase (hydrolysing) [EC:3.2.1.183]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0070 (synX)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.183  UDP-N-acetylglucosamine 2-epimerase (hydrolysing)
     NMB0070 (synX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase_2 baeRF_family2
Motif
Other DBs
NCBI-GeneID: 902176
NCBI-ProteinID: NP_273134
UniProt: H2VFI5
Position
complement(79114..80247)
Genome map
AA seq 377 aa AA seqDB search
MKRILCITGTRADFGKLKPLLAYIENHPDLELHLIVTGMHMMKTYGRTYKEVTRENYQHT
YLFSNQIQGEPMGAVLGNTITFISRLSDEIEPDMVMIHGDRLEALAGAAVGALSSRLVCH
IEGGELSGTVDDSIRHSISKLSHIHLVANEQAVTRLVQMGEKRKHIHIIGSPDLDVMASS
TLPSLEEVKEYYGLPYENYGISMFHPVTTEAHLMPQYAAQYFKALELSGQNIISIYPNND
TGTESILQELLKYQSDKFIAFPSIRFEYFLVLLKHAKFMVGNSSAGIREAPLYGVPSIDV
GTRQSNRHMGKSIIHTDYETKNIFDAIQQACSLGKFEADDTFNGGDTRTSTERFAEVINN
PETWNVSAQKRFIDLNL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattctttgcattacaggtaccagagccgacttcggcaagctaaaaccttta
ttagcctatattgaaaatcacccagaccttgaattgcatttgattgtaactggtatgcat
atgatgaaaacatatggcagaacctacaaggaagtaactcgagaaaactatcaacataca
tatctgttttcaaatcaaatccaaggtgaaccaatgggtgccgttttaggcaataccatt
acgtttatctctcgtctatctgatgaaattgaacctgatatggtcatgattcacggcgac
cgtttagaagcactagcaggcgcagctgtaggtgcattaagcagccgtttagtttgccat
atcgaaggtggtgaactatctggtacagtagatgactccattcgtcattctattagtaaa
ctttctcatatccacttggtagcaaatgaacaagctgtcactcgcctagtgcaaatggga
gaaaaaagaaagcatattcacatcatcggctcccccgatttagatgttatggcctcttcc
accctcccatccttagaagaagtcaaagaatattacggtttaccatacgaaaattatggt
atttctatgtttcaccccgtgactacagaagcacatttaatgccacaatatgcggcccaa
tatttcaaagcattagaattaagtggccaaaatatcattagcatctaccctaataatgac
actggcactgaaagtattctgcaagaattattaaaatatcaatctgataaatttattgca
tttccttccattcgatttgaatattttttagtcttattgaaacatgctaaatttatggtc
ggcaactcaagtgcaggtattagagaagctcctctctacggtgtcccttcaattgatgtt
ggtacacgccaaagtaaccgccatatgggaaaatctattattcatacagattatgaaact
aaaaatatctttgatgcgattcaacaagcatgcagtttaggcaaatttgaagcagatgat
acctttaatggcggagatactcgcaccagcacagaaagatttgctgaagtaatcaacaat
cctgaaacgtggaatgtttctgctcaaaaacgttttatcgatttgaatctttaa

DBGET integrated database retrieval system