KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0089Help
Entry
NMB0089           CDS       T00027                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00230  Purine metabolism
nme00620  Pyruvate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
nme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0089 (pykA)
   00620 Pyruvate metabolism
    NMB0089 (pykA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0089 (pykA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nme04131]
    NMB0089 (pykA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB0089 (pykA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     NMB0089 (pykA)
Membrane trafficking [BR:nme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NMB0089 (pykA)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB0089 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 902193
NCBI-ProteinID: NP_273151
UniProt: Q9K1M1
Position
complement(101492..102964)
Genome map
AA seq 490 aa AA seqDB search
MNQTSRDLTRISHNTKIVATLGPGSNNVELLEDMIRVGGLNVVRFNFSHGTPEFHQENAL
IVREAAKRAGQEIAIIADLQGPKIRVGKIAGGGIELNKGETLVLDAALEGEGTREAVGLD
YRDLPDDVAAGDVLWLDDGLLTLTVESVEGSRIITRVENSHVLKSNKGINKRGGGLSAGA
LTEKDFRDLKTAIAIGCDYLAISFVKSAEDLHIARAKVEEEMKGSTAVRPGLVSKIERVE
AIENLDEIILAGDGIMVARGDLAVEVGHAAVPALQKRMIRRARELRRFSITATQMMESMI
TNPVPTRAEVSDVANAVLDGTDAVMCSAETAVGAYPFETVSQMAIICAAAEKEQDSLNGV
AEQVEYPEAVSTNLAVAGGAVSVARAVHAKAIVALTESGSTAFEISRHNITLPIFALTPS
VSAQRRMAMYRGVRPLILATSTDHDTALNEVETMLVEHNILHSGDQYIITSGSQMRESGS
TNTLEVLRVK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacaagccgcgatctgacccgcatcagccacaacactaaaatcgtcgccacc
cttgggccgggcagcaacaacgtcgaactgttggaagacatgatccgcgtcggcggtctg
aacgtcgtccgcttcaacttcagccacggcacgcccgaattccatcaggaaaacgccctc
atcgtgcgcgaggcggcaaaacgcgccggacaggaaatcgccatcattgccgacctgcag
ggcccgaaaatccgcgtgggcaaaatcgccggcggcggcatcgaattgaacaaaggcgaa
acgctggtactggatgccgcgctcgaaggcgaaggcacgcgcgaggcggtcggtttggac
taccgcgacctgcccgacgacgttgccgcaggcgatgtcttgtggctggacgacggcctg
ctgaccctgaccgtggaatccgtcgaaggcagcaggattatcacaagggtggaaaacagc
cacgtcctgaaaagcaacaagggcatcaacaaacgcggtggcggtctgtccgcaggcgcg
ttgaccgaaaaagacttccgcgacctgaaaaccgcgattgccatcggttgcgactacctc
gccatcagctttgtgaaatccgccgaagatttgcatatcgcgcgcgccaaagtcgaagaa
gaaatgaagggcagcacggccgtgcgccccggtttggtttccaaaatcgaacgcgtggaa
gcgattgaaaacttggacgaaatcatcctcgccggcgacggcattatggttgcgcgcggc
gacttggcggtcgaagtcggacacgccgccgtccccgccctgcaaaaacggatgatccgc
cgcgcccgcgagttgcgccgcttcagcattacggcgacgcaaatgatggaatcgatgatt
accaaccccgtaccgacccgcgcggaagtcagcgatgtggcaaacgcggtattggacggt
accgatgcggtgatgtgttccgccgaaaccgccgtcggcgcgtatccgtttgaaaccgtc
agccaaatggcgattatctgcgcggctgcggaaaaagagcaggattcgctcaacggcgtt
gccgaacaggtcgagtatcccgaagcggtcagcaccaacctggcggttgccggcggtgcg
gtcagcgtggcgcgcgcggttcacgccaaagccatcgtcgccctgaccgaaagcggttcg
accgcctttgaaatcagccgccacaacatcaccctgccgattttcgcgctgaccccgagc
gtttccgcccaacgccgtatggcgatgtaccggggcgtgcgcccgctgattttggcaacc
agtaccgaccacgacacggcgttaaacgaagtcgaaacgatgctggtggaacacaacatc
ctgcattccggcgaccaatacatcattaccagcggttcgcaaatgcgcgaatccggttcg
accaacacactggaagtgctgcgcgtcaaataa

DBGET integrated database retrieval system