KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0107Help
Entry
NMB0107           CDS       T00027                                 

Gene name
pyrI
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00610  aspartate carbamoyltransferase regulatory subunit
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00240  Pyrimidine metabolism
nme00250  Alanine, aspartate and glutamate metabolism
nme01100  Metabolic pathways
Module
nme_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0107 (pyrI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0107 (pyrI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PyrI PyrI_C PriA_CRR zf-H2C2_2 zf-BED Elf1
Motif
Other DBs
NCBI-GeneID: 902211
NCBI-ProteinID: NP_273165
UniProt: Q9K1K9
Position
115373..115831
Genome map
AA seq 152 aa AA seqDB search
METPKLSVEAIEKGTVIDHIPAGRGLTILRQFKLLHYGNAVTVGFNLPSKTQGSKDIIKI
KGVCLDDKAADRLALFAPEAVVNTIDNFKVVQKRHLNLPDEIAEVFRCPNTNCAGHGEPV
KSRFYVKKHNGQTRLKCHYCEKTYSRDSVAEA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccgaaactcagtgtcgaagccattgaaaaaggtacggttatcgaccatatt
cccgccggcagggggctgaccatcctgcgccagttcaaacttttgcactacggcaacgcg
gtaaccgtgggcttcaacctgcccagcaaaacccaaggcagcaaagacatcatcaaaatc
aaaggcgtgtgcttggacgacaaagccgccgaccgcctcgccctgttcgcccccgaagcg
gtggtcaacaccatcgacaatttcaaggtcgtgcagaagcggcatttgaacctgcccgac
gaaatcgccgaagtgttccgctgtccgaacacgaattgcgccggccacggcgagccggtc
aaaagccggttttatgttaaaaagcacaacgggcagacgcggctgaaatgccactactgc
gaaaaaacctacagccgggattcggtggcggaagcctga

DBGET integrated database retrieval system