KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0175Help
Entry
NMB0175           CDS       T00027                                 

Definition
(RefSeq) zinc transporter ZupT
  KO
K07238  zinc transporter, ZIP family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0175
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zip CPP1-like
Motif
Other DBs
NCBI-GeneID: 902282
NCBI-ProteinID: NP_273233
UniProt: Q9K1H6
Position
complement(171356..172165)
Genome map
AA seq 269 aa AA seqDB search
MPDFSMSNLAVAFSITLAAGLFTVLGSGLVMFSKTPNPRVLSFGLAFAGGAMVYVSLTEI
FSKSSEAFAEIYDKDHAFAAATMAFLAGMGGIALIDRLVPNPHETLDAQDPSFQESKRRH
IARVGMMAAFAITAHNFPEGLATFFATLENPAVGMPLALAIAIHNIPEGISIAAPVYFAT
RSRKKTVWACLLSGLAEPLGAALGYLVLQPFLSPAVFGSVFGVIAGVMVFLALDELLPAA
KRYSDGHETVYGLTTGMAVIAVSLVLFHF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatttttcgatgtccaatttggccgttgccttttccatcacattggctgccggt
ttgtttaccgtattaggcagtggcttggtgatgttttccaaaacgcccaatccgcgtgtg
ttgtcgtttggtttggcgtttgccggcggtgcgatggtatatgtttccctgacggagatt
ttcagtaagtccagcgaggcgttcgctgaaatttatgataaagaccacgcgtttgcggcg
gcgaccatggcatttttggccgggatgggcggcattgcgctgattgaccgtctggtgccg
aacccgcatgaaactttagacgcgcaagacccgtcgtttcaagaaagcaaacgccgccat
atcgcgcgagtcggcatgatggcggcgtttgcgattactgcgcacaatttccccgaaggc
ttggcgacgttttttgccacattggaaaatccagcagtcgggatgcctttggccttggcg
attgccatccataatattccggagggcatttccatcgccgcgccggtttattttgccacc
cgcagccgtaagaaaacggtgtgggcgtgtctgctatccggcttggccgagccgttgggg
gcggctttgggctatttggttttgcagccgtttttgtcgcctgccgtgtttggttcggta
ttcggcgtgatagccggtgtgatggtgtttttggcgttggacgagctgctgccggctgcc
aaacgctattcagacggccatgaaaccgtttacggcctgacaacgggtatggcggtgatt
gccgtcagcctggtattgttccatttttaa

DBGET integrated database retrieval system