KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0176Help
Entry
NMB0176           CDS       T00027                                 

Gene name
dadA
Definition
(RefSeq) D-amino acid dehydrogenase small subunit
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NMB0176 (dadA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     NMB0176 (dadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_2 Pyr_redox HI0933_like NAD_binding_8 Amino_oxidase Pyr_redox_3 GIDA AlaDh_PNT_C ApbA FAD_binding_3 3HCDH_N UDPG_MGDP_dh_N Thi4 TrkA_N
Motif
Other DBs
NCBI-GeneID: 902283
NCBI-ProteinID: NP_273234
UniProt: Q9K1H5
Position
complement(172346..173602)
Genome map
AA seq 418 aa AA seqDB search
MKVLVLGAGVAGVSSAWYLAEAGHEVTVIDRAEGVAMETSFANAGQLSYGYTTPWAAPGI
PTKALKWLFKSHPPLLFRPDGSLYQIEWLWQMLQNCTAAHYQTNKERMVRISEYSREMFR
RFEAQTGMNFEGRKKGTLQIFRQTKEVEAAKQDIAVLERYGVPYRRLKPEECAEFEPALA
RVTAKIAGGLHLPADATGDCRLFTENLYKLCQEKGVRFHFNQNISRIDHNGLRIKTVETE
TGRFEADAVVCALGCFSRTVLAQLDLNLPIYPVKGYSLTLPVTNSDGAPVSTVLDESYKV
AITRFDNRIRVGGMAELSGYEIKLPEKRRETLALVVNDLFPEGGDLSQASFWSGLRPMTP
DSTPLIGRTRFDNLFLNTGHGTLGWTMSLGSAKLTADIVSGKDTEIRSDDLSLSRYQA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcttgttttaggtgcgggtgttgccggcgtgtcttccgcgtggtatctggca
gaggccggacatgaagtaacggtcatcgaccgcgccgagggtgtggcgatggaaaccagt
tttgccaacgcaggccagctttcttacggctataccacgccttgggctgcacccggtatc
ccgaccaaagcgctgaaatggctgtttaaaagccatccgcctttgctgtttcgccccgac
ggcagcctgtatcaaatcgaatggctgtggcaaatgctgcaaaactgcacggcagcgcac
tatcaaaccaataaagagcgcatggtcaggatttccgaatacagccgtgaaatgttccgc
cgttttgaagcgcaaaccggcatgaattttgagggacgcaaaaaagggacgttgcagatt
ttccgccaaaccaaagaagtcgaagcggcaaaacaagacattgccgttttggaacgctac
ggcgtgccgtaccgccgtctgaaacccgaagaatgtgcagaatttgagcctgcgctggca
cgcgttaccgccaaaattgccggcggcctgcacctgcctgcagatgcgaccggcgactgc
cgcctcttcactgaaaacctatacaaattgtgtcaggaaaagggcgtacggtttcatttc
aaccaaaacatcagccgcatcgaccacaacgggctgcgcatcaaaaccgttgaaaccgaa
acagggcggtttgaagcagatgccgttgtctgcgcgctcggttgcttcagcaggacggtt
ttggcgcagttggatctcaatctgcccatttatcccgtcaaaggctattccttgaccctg
ccggtcaccaattcagacggcgcaccggtgtccaccgttttagatgaaagctacaaagtc
gccatcacgcgctttgacaacagaatccgcgtcggcggtatggcggaattgtcgggctac
gaaatcaaactgcccgaaaaacgccgcgaaaccttggctttggtcgtcaacgacttgttc
ccggaaggcggcgatttgagccaagcatcgttctggagcggcctcagaccgatgacgccc
gacagcacgccgttaatcggtcgcacccgctttgacaacctgtttctgaataccggccac
ggtactttaggctggaccatgtcgctgggttcggcaaaattaaccgccgatatcgtgagc
ggcaaagacaccgaaatccgcagcgacgatttgagcctgtcgcgttatcaggcttaa

DBGET integrated database retrieval system