KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0178Help
Entry
NMB0178           CDS       T00027                                 

Gene name
lpxA
Definition
(RefSeq) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
nme01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0178 (lpxA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NMB0178 (lpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB0178 (lpxA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     NMB0178 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0178 (lpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Acetyltransf_11 Hexapep_2
Motif
Other DBs
NCBI-GeneID: 902285
NCBI-ProteinID: NP_273236
UniProt: P95379
Position
complement(175429..176205)
Genome map
AA seq 258 aa AA seqDB search
MTLIHPTAVIDPKAELDSGVKVGAYTVIGPNVQIGANTEIGPHAVINGHTSIGENNRIFQ
FASLGEIPQDKKYRDEPTKLIIGNGNTIREFTTFNLGTVTGIGETRIGDDNWIMAYCHLA
HDCVIGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGDYAMTAFAAGVHKDVPPY
FMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQA
ELAVFRDFFAQSARGIIR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatccacccgaccgccgtcatcgaccccaaagccgaactcgactccggcgtc
aaagtcggcgcgtacaccgttatcggccccaacgtccaaatcggcgcgaataccgaaatc
ggtccgcacgccgtcatcaacggccacaccagcatcggcgaaaacaaccgcattttccaa
tttgccagcctcggcgaaatcccgcaggacaaaaaataccgcgacgagccgaccaagctg
attatcggcaacggcaacaccatccgcgaattcaccacctttaatttaggtacggtaacc
ggcatcggcgaaacccgtatcggcgacgacaactggattatggcgtactgccacctcgcg
cacgactgcgtcatcggcaaccacaccattttcgccaacaacgcctcgcttgccggacac
gttaccatcggcgactacgtcgttttgggcggctacacgctggttttccaattctgccgc
atcggcgactacgccatgaccgcgtttgccgcaggcgtacacaaagacgtgccgccctac
tttatggcatcgggctaccgcgccgaaccggcggggctcaacagcgaaggcatgcgccgc
aacggttttaccgcagagcagatttccgccgtcaaagacgtgtacaaaaccctctaccat
cgcggcattccgtttgaagaagccaaggcagacattctccgccgcgccgaaacccaagcc
gagcttgccgtattccgagactttttcgcacaatcggcgcgcggcatcatccgctga

DBGET integrated database retrieval system