KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0181Help
Entry
NMB0181           CDS       T00027                                 

Definition
(RefSeq) outer membrane protein OmpH
  KO
K06142  outer membrane protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpH Thermopsin CAF1 Pox_A_type_inc APG6 DUF4404
Motif
Other DBs
NCBI-GeneID: 902288
NCBI-ProteinID: NP_273239
UniProt: Q9K1H1
Position
complement(177854..178354)
Genome map
AA seq 166 aa AA seqDB search
MTRLTRAFAAALIGLCCTAGAHADTFQKIGFINTERIYLESKQARKIQKTLDSEFSARQD
ELQKLQREGLDLERQLAEGKLRNAKKAQAEEKWRGLVAAFRKKQAQFEEDYNLRRNEEFA
SLQQNANRVIVKIAKQEGYDVILQNVIYVNTQYDVTDSVIKEMNAR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttgacccgcgcgtttgccgcggctctgatcggtttgtgctgcaccgcaggc
gcgcacgccgacaccttccaaaaaatcggctttatcaacaccgagcgcatctacctcgaa
tccaagcaggcgcgcaagattcaaaaaacgctggacagcgaattttccgctcgtcaggac
gaattgcaaaaactgcaacgcgaaggtctggatttggaaaggcagcttgccgaaggcaaa
ctcagaaacgcaaaaaaggcgcaagccgaagaaaaatggcgcgggctggtcgcagcgttc
cgcaaaaaacaggcgcagtttgaagaagactacaacctccgccgcaacgaagagtttgcc
tccctccagcaaaacgccaaccgcgtcatcgtcaaaatcgccaaacaggaaggttacgat
gtcattttgcagaacgtgatttacgtcaacacccaatacgacgttaccgacagcgtcatt
aaagaaatgaacgcccgctga

DBGET integrated database retrieval system