KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0184Help
Entry
NMB0184           CDS       T00027                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0184 (dxr)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NMB0184 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP Mur_ligase
Motif
Other DBs
NCBI-GeneID: 902291
NCBI-ProteinID: NP_273242
UniProt: Q9K1G8
Position
complement(182245..183429)
Genome map
AA seq 394 aa AA seqDB search
MTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFHPEYAVVAD
AEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAVGLPSALAAAQKGK
TIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLPRDYAGRLNEHGIASIIL
TASGGPFLTADLNTFDRITPAQAVKHPNWRMGRKISVDSATMMNKGLELIEAHWLFNCPP
DKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGDLDFDALS
ALTFQKPDFDRFPCLRLAYEAMNAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHC
LAQDFSDGIGDIGGLLAQDARTRAQARAFIGTLR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacaagtcctgaccatattaggcagtaccggcagcataggcgaaagcacgctg
gacgttgtctcccgccaccccgaaaaattccgcgtattcgcgctggcagggcataagcag
gtcgagaaattggcggctcaatgtcaaacgttccaccccgaatatgccgtcgttgccgat
gcggaacacgccgcccggcttgaagccctgttgaaacgcgacggcacggcgactcaggtt
ttacacggcgcgcaggcattggttgacgttgcctctgccgacgaagtcagcggtgtcatg
tgcgccatcgtcggggcggtggggctgccttccgcgctcgcagcggcgcaaaaaggcaaa
accatttatctggcaaacaaagaaacgctggtggtttccggcgcgttgtttatggaaacc
gcccgtgcaaacggcgcggcagtgctgcccgtcgacagcgaacacaacgccgttttccaa
gttttgccgcgcgattacgccggccgtctgaacgaacacggcatcgcttcgattatcctg
accgcttccggcggcccgtttctgaccgccgatttaaacacgttcgaccgcattacgccc
gcccaagcggtcaaacaccccaattggcgtatgggacgcaaaatctccgtcgattccgcc
accatgatgaacaaaggtttggagctgattgaagcgcattggctgttcaactgtccgccc
gacaaactcgaagtcgtcatccatccgcaatccgtgatacacagcatggtgcgctaccgc
gacggctccgtgctggcgcaactgggcaatcccgatatgcgaacgcccatcgcttattgt
ttgggtttgcccgagcgcatcgattcgggtgtcggcgacctggatttcgacgcattgtcc
gcgctgaccttccaaaagcccgactttgaccgcttcccctgcctgaggctcgcctatgaa
gccatgaacgcaggcggagccgcgccctgcgtattgaacgccgccaacgaagccgccgtc
gccgcctttttggacggacagattaagtttaccgacattgccaaaaccgtcgcccactgt
cttgcacaagacttttcagacggcataggcgatataggggggctcttggcgcaagatgcc
cggacacgcgcacaagcgcgagcatttatcggcacactgcgctga

DBGET integrated database retrieval system