KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0185Help
Entry
NMB0185           CDS       T00027                                 

Gene name
cdsA
Definition
(RefSeq) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00564  Glycerophospholipid metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Module
nme_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB0185 (cdsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     NMB0185 (cdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1 CarS-like DUF2754
Motif
Other DBs
NCBI-GeneID: 902292
NCBI-ProteinID: NP_273243
UniProt: Q9K1G7
Position
complement(183485..184282)
Genome map
AA seq 265 aa AA seqDB search
MLKQRVITAMWLLPLMLGMLFYAPQWLWAAFCGLIALIALWEYARMGGLCKIKTNHYLAA
TLVFGVVAYAGGWMLPNLVWYVVLAFWLAVMPLWLRFKWRLNGGWQVYAVGWLLVMPFWF
ALVSLRPHPDDALPLLAVMGLVWVADICAYFSGKAFGKHKIAPAISPGKSWEGAIGGAVC
VAVYMTAVRSAGWLAFDTGWFDTVLIGLVLTVVSVCGDLLESWLKRAAGIKDSSKLLPGH
GGVFDRTDSLIAVISVYAAMMSVLN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacaacgggtaataaccgccatgtggctgctgccgctgatgctgggcatgctg
ttttacgcgccgcaatggttgtgggctgcattttgcggactgattgccctgattgccttg
tgggaatatgcccgtatgggcggtttgtgcaaaattaaaaccaaccattacctcgccgca
accttggttttcggcgtggttgcctatgcgggcggctggatgctgcctaatttggtttgg
tatgttgttttggcattttggctcgccgttatgcctttatggttgagattcaaatggagg
ctcaacggcggttggcaggtttatgccgtcggctggcttctggtcatgccgttttggttc
gcgctcgtatccctgcgcccgcatcccgatgatgccctgccgctgctcgccgtgatgggt
ttggtgtgggttgccgatatttgcgcgtatttcagcggcaaggcgttcggcaaacacaaa
atcgcgccggcaatcagccccggcaaaagctgggaaggtgcaatcggcggcgcggtttgc
gtggcagtgtacatgaccgccgtacgaagtgccggctggctggcattcgatacaggctgg
ttcgataccgtgttaatcggtttggtgctgaccgttgtcagcgtatgcggcgaccttttg
gaaagctggctcaagcgcgcggcaggcatcaaagacagcagcaagctgctgcccggacac
ggcggcgtgttcgaccgtaccgacagcctgattgccgttatcagcgtctatgcagcgatg
atgtcggttttaaattga

DBGET integrated database retrieval system