KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0186Help
Entry
NMB0186           CDS       T00027                                 

Gene name
uppS
Definition
(RefSeq) undecaprenyl pyrophosphate synthetase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0186 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nme01006]
    NMB0186 (uppS)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     NMB0186 (uppS)
Prenyltransferases [BR:nme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMB0186 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf Dor1 DUF3654
Motif
Other DBs
NCBI-GeneID: 902293
NCBI-ProteinID: NP_273244
UniProt: Q9K1G6
Position
complement(184285..185031)
Genome map
AA seq 248 aa AA seqDB search
MKSSTQAVLEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQ
YLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILQG
IEEAEALTANNTGLTLSIAADYGGRWDILQAANKLIAEGVSEITEDTLAKHLMLGDAPEP
DLFIRTGGETRISNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQ
LPIEQQRN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcagcacgcaggccgttttggaacacaccgccattcccaagcatatcgccgtg
attatggacggcaacggccgttgggcgaaaaaacgtttcctcccgcgcataatgggacac
aaacgcggtttggacgcattggaaaatatggtgaagcattgcgccaaactgggtgtgcaa
tatctgaccgtgtttgccttttcaaccgaaaactggcgccgccccgaagacgaagtttcg
ttcctgatggggctgtttttacaggctttgcaaaaacaggtacgccgcctgcacgaaaac
aatatgcgcctgaagatattgggcagccgcgaacgcttcaaccggcagattctgcaaggc
atcgaagaggcggaagcgttgacggcaaacaataccggcctgaccctgagcattgccgcc
gattacggcggccgctgggatattttgcaggcggcaaacaaactgattgccgaaggcgta
tccgagattacggaagacacgctggcgaaacacttgatgctgggcgatgcaccggaaccg
gatttgttcatccgcaccggcggcgaaacgcgcatcagcaatttcctgctctggcagatg
gcatatgcagaactgtatttcaccgatattttgtggcccgattttgacggcaaggctttg
gacgatgccgtcgcttcgttccaaaaacgcgaacggcggttcggacgcacctccgagcaa
ctgcctatcgaacagcaaaggaactga

DBGET integrated database retrieval system