KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0199Help
Entry
NMB0199           CDS       T00027                                 

Gene name
lpxB
Definition
(RefSeq) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0199 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nme01003]
    NMB0199 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB0199 (lpxB)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     NMB0199 (lpxB)
Glycosyltransferases [BR:nme01003]
 Polysaccharide
  Bacterial polysaccharide
   NMB0199 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0199 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-GeneID: 902307
NCBI-ProteinID: NP_273257
UniProt: Q9K1F5
Position
201737..202909
Genome map
AA seq 390 aa AA seqDB search
MWGQTNMADKKSPLIAVSVGEASGDLLGAHLIRAIRKRCPQARFTGIGGELMKAEGFESL
YDQERLAVRGFVEVVRRLPEILRIRRGLVRDLLSLKPDVFVGIDAPDFNLGVAEKLKRSG
IPTVHYVSPSVWAWRRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEFVGHPMAQLMPL
EDDRETARQTLGVDAGIPVFALLPGSRVSEIDYMAPVFFQTALLLLERYPAARFLLPAAT
EATKRRLAEVLQRPEFAGLPLTVIDRQSETVCRAADAVLVTSGTATLEVALCKRPMVISY
KISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQSEAKPEKLAAALADWYEHPDKVAA
LQQDFRALHLLLKKDTADLAARAVLEEAGC
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtggggacagacgaatatggctgataaaaaaagccctttgattgccgtcagtgtcggc
gaagcgtcgggcgacctattgggggcgcacctgatacgcgccatccgcaagcgttgtccg
caggcgcggtttaccggtatcggcggcgaactgatgaaggcggaaggtttcgagagcctt
tatgatcaggagcggctggcggtgcgcggctttgtcgaagtggtcaggcggctgccggaa
attttacggatacgcagggggctggtacgggatttgctgtcgttgaaacctgatgtcttt
gtcggtatcgatgcgcccgattttaatttgggtgtggcggaaaagctgaaacggtcgggg
attccgaccgtgcattatgtcagcccgtcggtgtgggcgtggcggcgggaacgtgtgggc
aaaatcgtgcatcaggtcaaccgcgtgttgtgcctgttcccgatggagccgcagctttat
ctcgatgcgggcggacgtgcggagtttgtcggtcatccgatggcgcagcttatgcccttg
gaagacgaccgtgaaacggcgcggcaaactttgggcgtggatgccggcatccccgtattc
gccctgctgcccggcagccgcgtcagcgaaatcgactatatggcgccggtgttttttcag
acggcattattgttgttggaacgctatcccgccgcacgcttcctgctgcctgccgcaacg
gaggcgacgaagcggcgtttggcggaagttttgcagcggccggagtttgccggattgccg
ctgacggtaatcgacagacagtctgaaacagtgtgcagggcggcggatgcggtgctggta
acgagcggtacggcaactttggaggtggcgttgtgtaagcgtccgatggtcatcagctac
aagatttcgccgctgacctatgcttatgtgaaacgcaaaatcaaagtgccgcatgtcggc
ctgccgaatatcctgttgggtaaggaggctgtgccggaattattgcaatctgaagcaaaa
ccggaaaaactggcggcggcgttggcggactggtacgaacaccccgataaggttgccgcg
ctgcaacaggatttcagggcgttgcacctgctgttgaaaaaagatacggcggatttggcc
gcgcgcgcggttttggaagaggcgggatgttga

DBGET integrated database retrieval system