KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0203Help
Entry
NMB0203           CDS       T00027                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00261  Monobactam biosynthesis
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0203 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB0203 (dapB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     NMB0203 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 902311
NCBI-ProteinID: NP_273261
UniProt: Q9K1F1
Structure
PDB: 

Position
complement(204405..205214)
Genome map
AA seq 269 aa AA seqDB search
MTPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLKTGIAIS
DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDTGKAAIHTAAEKTGI
VFAANFSVGVNLTFHILDTVARVLNEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGALG
RDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRMTF
AAGAVRAAVWVNGKTGLYDMQDVLGLNNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctcaaaatcgccatcgccggcgcaaacggccgtatgggacgcgtattggtt
gaagccgtcaacaaccatcccgacaccgtcctttccggtgcgcttgaacactcaggctca
gaagccctcgggctggacgcaggctacgccgtcggactcaaaaccggcatcgccatttca
gacgacgttgacgccgttctcgcacaaagcgacgtactcatcgacttcacccgccccgag
cccaccctcaaacacctgcaaaaatgcgttgaaaaacaagtcaacatcatcatcggcaca
acaggcttcgacgatacgggcaaagccgctatccacactgccgccgaaaaaacaggcatc
gttttcgccgccaacttcagcgtcggcgtcaacctcaccttccacatcctcgacaccgtc
gcacgcgtattaaacgaaggctacgacatcgaaatcattgaaggccaccaccgccacaaa
gtcgatgcccccagcggcaccgcgttacgcatgggcgaagtcatcgccggcgcgctcggc
agagacctcaaacaatgcgccgtttacggccgcgaaggccacaccggtccgcgcgatccg
tcgaccatcggctttgccaccgtccgcgcaggcgacatcgtcggcgaccacaccgccctc
ttcgccaccgacggcgagcgcgtggaaatcacccacaaggccagcagccgcatgaccttt
gccgccggtgccgtccgcgccgcagtttgggtcaacggcaaaacgggtttgtacgatatg
caggacgtactcgggctgaacaaccgttaa

DBGET integrated database retrieval system