KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0209Help
Entry
NMB0209           CDS       T00027                                 

Gene name
kefB
Definition
(RefSeq) glutathione-regulated potassium-efflux system protein
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NMB0209 (kefB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N TrkA_C
Motif
Other DBs
NCBI-GeneID: 902317
NCBI-ProteinID: NP_273267
UniProt: Q9K1E6
Position
209520..211496
Genome map
AA seq 658 aa AA seqDB search
MNEFSLAPIVIVLLVSVITVILCRKFNIPSMLGYLLVGFLAGPGMLSLIPKSHATDYLGE
IGIVFLMFSIGLEFSLPKLRAMRRLVFGLGGLQVGITMLSVMGILMLTGVPFNWAFAVSG
ALAMSSTAIVSRILSEKTELGQPHGQMAMGVLLMQDIAVVPLMILIPALAGGGDGNIWAA
LGLAFAKMLLTLGLLFFVGSKIMSRWFRMVAKRKSSELFMINVLLVTLGVAYLTELEGLS
MALGAFVAGMLLSETEYRFQVEDDIRPFRDILLGFFFITVGMKLDIQALIGGWRQVLMLL
AMLLVLKALVVFAIAFKMKHSVGDSLKTALYLAQGGEFGFVMLAIAGQLDMVSPEWEQAA
TAAVLLSMIIAPFLLGGSDALVGRLVKSSWDMKSLDLHSMLVETMSKSDHVLIVGFGRGG
QTVGRVLAQEDIPYFALDLDIARVQVARSAGEPVSFGDAKRREVLEAAGLGRAKMVVVTL
NNMHETQHVLDNVLSMYPNMPVYVRATNDDYVKTFTDIGAEEAVSDTKETGLVLAGYAML
GNGASYRHVYQTMANIRHSRYAALEGLFVGSDDEAGFGENGETVRHAFPLAAEAYAVGKT
VGTLPMAAYGIKLLFVRRRTGRIENPDASFTLEGGDVLVVAGKKEEIISFENWSLQGI
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaattttcgcttgcccctattgtgattgttttgctggtgtcggtcattacggtg
atcctgtgccgcaagttcaacattccctccatgctgggctacctgctggtgggctttttg
gcggggcccggtatgctcagcctgattccgaaaagccatgcgacggattatttgggcgaa
atcgggattgtgttcctgatgttcagcatcggtttggagttctcgctgcccaagttgagg
gcgatgaggcggctggtgttcggtctgggcggtttgcaggtcggcattacgatgctgtcg
gtaatgggcatactgatgctgacgggcgtgccgttcaattgggcgtttgccgtgtcgggc
gcgttggcgatgtcgtccacggcgattgtgagccggattttgtcggaaaagacggaattg
gggcagccgcacggtcagatggcgatgggcgtgctgctgatgcaggacatcgccgtcgtg
ccgctgatgattctgattcccgcgctggcgggcggaggggacggaaatatttgggcggcc
ttgggtttggcgtttgcaaaaatgctgctgacgctggggctgctgtttttcgtcggcagc
aaaattatgtcgcgatggttcaggatggtggcaaaacgcaaatcgtccgaactctttatg
atcaatgtgctgctggtaaccttgggtgtggcttatctgactgagctggaaggtttgtct
atggcgttgggcgcattcgttgccggcatgctgctttcggaaacggaataccgtttccaa
gtcgaagacgacatccgcccgttccgcgatattttgctcggctttttctttatcacggtc
ggcatgaagctggacattcaggcattgatcggcggctggcggcaggtattgatgctgttg
gcaatgctgctggtgttgaaggcactggttgtgtttgccattgccttcaaaatgaaacat
tcggtcggcgacagcctcaaaacggctttgtatctcgcgcagggcggcgagttcggcttc
gtgatgctggccattgccgggcagcttgatatggtttcgccagaatgggaacaggcggcg
acggcggcggttctgctgtcgatgattatcgcgcccttcctcttgggcggcagcgatgcg
ctggtcgggcgtttggtcaagtcaagctgggacatgaagtcgctcgatctgcacagtatg
ctggtagaaaccatgagcaagtccgaccatgtgctgattgtcggcttcggcaggggcggg
cagacggtcggacgcgtccttgcccaagaggatattccgtatttcgcgctcgacttggac
attgcgcgggtgcaggttgccagaagtgcgggcgaaccggtgtcgttcggcgatgcgaaa
cgcagggaagtattggaagccgccggtctgggacgggcgaaaatggtggtggttacgctc
aacaatatgcacgaaacgcaacacgttttagacaatgtgctgtccatgtatcccaatatg
cccgtatatgtgcgcgccaccaacgacgattatgtgaaaacgtttaccgatataggtgcg
gaagaagccgtgtcggacaccaaagaaaccggactcgtgctggcaggctatgcaatgtta
ggcaacggcgcgtcgtatcggcacgtctatcagacgatggcaaatatccgccacagccgt
tatgccgcgttggagggactgtttgtcggtagtgatgatgaggcaggattcggcgaaaac
ggcgaaaccgtccgtcacgcctttcctttggctgcagaagcatacgccgtcggcaaaaca
gtcggcacgcttccgatggcggcttacggcatcaaactcttgttcgtccgccgccgcacc
ggccggattgaaaacccggatgcctcgtttacattggaaggcggtgacgtgttggtggtc
gcaggcaaaaaagaagaaattatctcttttgaaaactggagtttgcagggaatataa

DBGET integrated database retrieval system