KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0216Help
Entry
NMB0216           CDS       T00027                                 

Gene name
kat
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00380  Tryptophan metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0216 (kat)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    NMB0216 (kat)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NMB0216 (kat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 902328
NCBI-ProteinID: NP_273273
UniProt: Q7DDS5
Position
complement(221438..222952)
Genome map
AA seq 504 aa AA seqDB search
MTTSKCPVTHLTMNNGAPVADNQNSLTAGPRGPLLAQDLWLNEKLADFVREVIPERRMHA
KGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGERGAADAERDIRGFALKF
YTEEGNWDVVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRSATNNWDFWTLLPEALHQV
TIVMSDRGIPAGYRHMHGFGSHTYSFWNEAGERFWVKFHFRTQQGIKNLTNEEAAKIIAD
DRESHQRDLYEAIERGEFPKWTMYIQVMPEADAEKVPYHPFDLTKVWPKKDYPLIEVGEF
ELNRNPENFFADVEQSAFAPSNLVPGVGASPDKMLQARLFNYADAQRYRLGVNFRQIPVN
RPRCPVHSNQRDGQGRADGNYGSLPHYEPNSFGQWQQQPDFAEPPLKINGDAAHWDYRQD
DDDYFSQPRALFNLMNDAQKQALFGNTAAAMGDAPDFIKYRHIRNCYRCDPAYGEGVAKA
LGLTVEDAQAARATDPALGQAGLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactacctccaaatgccctgtaacccatctgaccatgaacaacggcgcgcctgttgcc
gacaatcaaaacagcctgaccgccggtcctcgcggccctctgctggcgcaggatttgtgg
ctgaatgaaaaactcgccgacttcgtgcgcgaagtcatccccgaacgccgtatgcacgcc
aaaggttcgggcgcgttcggtacgtttaccgtaacgcacgacatcaccaaatacacccgc
gccaaaatcttcagcgaagtcggcaaaaaaaccgagatgttcgcccgtttcaccaccgtg
gcaggcgaacgcggcgcagccgatgcagaacgcgacatccgcggttttgccttgaaattt
tataccgaagaaggcaactgggatgtggtcggcaacaacacgcccgtgttcttcctgcgc
gacccgcgtaagttccccgacctgaacaaagccgtcaaacgcgacccgcgcaccaatatg
cgctctgccacaaacaactgggacttctggacgctgctgcccgaagcactgcaccaagtt
accatcgtgatgagcgaccgcggcatccccgccggctaccgccatatgcacggcttcggt
tcgcatacctacagcttctggaacgaagcaggcgagcgtttttgggtgaaattccatttc
cgcacccaacaaggcattaaaaacctgaccaacgaagaagccgccaaaatcatcgccgac
gaccgcgaaagccatcagcgcgacttatacgaagccatcgaacgcggcgagtttccgaaa
tggacgatgtacatccaagtcatgcctgaagcagacgcggaaaaagtaccttatcatccg
tttgacttgaccaaagtttggccgaaaaaagactatccgctgattgaagtgggcgaattc
gagttgaaccgcaatcccgaaaacttcttcgccgatgtggaacaatccgccttcgcaccg
agcaacctcgttcccggtgtcggcgccagcccagataaaatgctgcaagcgcgtttgttc
aattacgccgacgcacaacgctaccgtttgggcgtaaacttccgccaaattcccgtcaat
cgtccgcgttgccctgttcacagcaaccagcgcgacgggcaaggccgcgccgacggcaac
tacggcagcctgccgcactacgaacccaacagcttcggccaatggcagcaacaacccgac
ttcgccgaaccgcctttgaaaatcaacggcgacgcggcacactgggactaccgccaagac
gatgacgactatttcagccaaccgcgcgccctgttcaacctgatgaacgacgcgcagaaa
caggcattgttcggcaacaccgccgccgcaatgggcgacgcgcccgacttcatcaaatac
cgccatatccgcaactgctaccgttgcgacccggcatacggcgaaggcgtggccaaagcc
cttggactgactgtcgaagatgcccaagccgcccgcgcgaccgatcccgcactgggtcag
gctggtttgctgtaa

DBGET integrated database retrieval system