KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0241Help
Entry
NMB0241           CDS       T00027                                 

Gene name
nuoA
Definition
(RefSeq) NADH dehydrogenase subunit A
  KO
K00330  NADH-quinone oxidoreductase subunit A [EC:7.1.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00190  Oxidative phosphorylation
nme01100  Metabolic pathways
Module
nme_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMB0241 (nuoA)
Enzymes [BR:nme01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     NMB0241 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q4
Motif
Other DBs
NCBI-GeneID: 902352
NCBI-ProteinID: NP_273297
UniProt: Q9K1C3
Position
246614..246970
Genome map
AA seq 118 aa AA seqDB search
MLSAYFPVFVFILIGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY
YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgcttactttcccgtctttgtctttatcctcatcggcctcgcggccggcgtg
ctgtttatcctgctcggcacgattttaggcccgaaacgccactatgccgaaaaagacgcg
ccttacgaatgcggttttgaagcttttgaaaacgccaggatgaagttcgacgtgcgctat
tacctcgtcgccatcctcttcatcctgtttgatttggaggtcgcgtttatgctgccgtgg
gcagtcgtgttcaaagatttgggcgcgtacggcttctggtctatgctggtgtttatcgtt
gttctgacggtaggctttgtttacgaatggaaaaaaggtgcgctggaatgggaatag

DBGET integrated database retrieval system