KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0261Help
Entry
NMB0261           CDS       T00027                                 

Gene name
ispA
Definition
(RefSeq) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0261 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nme01006]
    NMB0261 (ispA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NMB0261 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NMB0261 (ispA)
Prenyltransferases [BR:nme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMB0261 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF3326
Motif
Other DBs
NCBI-GeneID: 902372
NCBI-ProteinID: NP_273317
UniProt: Q9K1A6
Position
complement(265091..265870)
Genome map
AA seq 259 aa AA seqDB search
MRYAALDGGKRLRPMLVLAASELGEAVHEAVEQAMAAIEMIHVYSLVHDDMPAMDNDSLR
RGKPTCHIKYGEATALLTGDALQTQAFDVLSRPTELPAARQLAMLSVLAKAGGSRGMAGG
QAIDLANVGKQMVQADLEQMHSLKTGALIRAAVLLGATACPDLSDAELSVLDAYAAKLGL
AFQVIDDVLDCEADTATLGKTAGKDADNDKPTYVKLMGLEAARSYAHKLVAEAVALLEPF
GDKALRLRQLAEFAVARKY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgcggctttggacggcggtaagcgtctgcggccgatgctggttctggcagct
tcggaattaggcgaagccgtgcatgaagcagtagaacaggcaatggcggcaatcgaaatg
atccacgtctattctttggttcacgacgatatgccggcgatggacaacgacagcctgcgg
cgcggcaaaccgacttgccacatcaaatatggcgaagcgaccgcccttctgaccggcgac
gctttgcagacacaggcatttgacgtgttgagccgtccgacagaactgcccgccgcacgc
cagttggcaatgttgtcggtgttggcgaaagcgggcggcagcaggggtatggcgggcggt
caggcaatcgatttggcgaatgtcggcaaacaaatggttcaagccgatttggaacagatg
cacagcctgaaaacgggtgcgctaatccgtgcggcggttttattgggggcgacggcgtgt
cctgatctgtcagatgcggaactttccgtattggacgcttacgcggcaaaactggggctg
gcgttccaagtcattgacgatgtgttggattgtgaagcggacacggcgactttgggcaaa
acggcgggcaaagacgcagacaacgacaagccgacttatgtgaaactgatgggcttggaa
gcggcgcgctcatacgcacacaaactggttgccgaagcggtcgcgctgctcgaacccttc
ggcgacaaagccctgcgcctgcggcagttggcagaatttgcagtcgcccgcaaatattaa

DBGET integrated database retrieval system