KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0275Help
Entry
NMB0275           CDS       T00027                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0275 (trpC)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMB0275 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-GeneID: 902386
NCBI-ProteinID: NP_273331
UniProt: Q9K192
Position
complement(277800..278582)
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILATKAQEVAAQKAAVNAEHIRTLAAEAAPVRSFIDSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEQEQLERFEAVAHELGMTVLLELHDETELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttgccaccaaagcacaggaagttgccgctcaaaaa
gccgccgtcaacgccgaacacatccgcacacttgccgcagaagccgcgcccgtccgcagc
ttcatcgattcgatacgcggcaaacaccgcctaaacctgcccgccgtcatagccgaaatc
aaaaaggcaagcccgagcaaagggttaatccgtccggacttccgccctgccgagattgca
cgcgcctatgaaaacgccggagcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgacgaataccaggtttatcaggcgcgcgcatggggggcggatgcc
gtcctgctgattgccgcagcactggaacaggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctactcgagctgcacgacgaaaccgaattggaaaaatgc
cgcaacctgaccacgccgctgtggggcgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggcaaggcggatgtggaatttatgcaatcgcgcggcgtgcataccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattgaagcagaagtgggcaaactattc
taa

DBGET integrated database retrieval system