KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0284Help
Entry
NMB0284           CDS       T00027                                 

Gene name
purB
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00250  Alanine, aspartate and glutamate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
nme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0284 (purB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0284 (purB)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     NMB0284 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C
Motif
Other DBs
NCBI-GeneID: 902395
NCBI-ProteinID: NP_273340
UniProt: Q9K183
Position
291263..292633
Genome map
AA seq 456 aa AA seqDB search
MINPIASLSPLDGRYAQSVEALRPIFSEYGLMKARVKVELNWLKALAAEPKIAEVPPFSA
ETLAEIDTVIENFSLEDAAAVKAIEATTNHDVKAIEYWLKKRFAEVPEVAAVSEFIHFAC
TSEDINNLSHALMLQEAREAVLLPKLAEIIEKLTAMAHDLAAVPMMSRTHGQPATPTTLG
KETANVVYRLQRQFKNLQAQEFLGKINGAVGNYNAHMVAYPDVDWETHCRNFVEISLGLT
FNPYTIQIEPHDYMAEFFQTLSRINTILIDFNRDVWGYISLGYFKQKVKAGEVGSSTMPH
KVNPIDFENSEGNLGMANAVLGFLSEKLPISRWQRDLTDSTVLRNMGVGVGYAVLGFAAH
LRGLNKLEPNPAALAADLDATWELLAEPIQTVMRRYGVANPYEKLKDLTRGKGGITPEVL
KGFIGLLEIPAEAKAKLLELTPALYVGKAEALAKRI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaccccatcgcctcgctttcccctttagatggccgttatgcccaatccgttgaa
gcattgcgcccgattttttccgaatacggcctgatgaaggcgcgcgtcaaagtcgaatta
aactggctcaaagccctcgccgccgagccgaagattgccgaagtgccgcccttcagtgcc
gaaacgcttgccgaaatcgacacggtgattgaaaacttttcattggaagacgcggccgcc
gtcaaagccatcgaagccaccaccaatcacgatgtcaaagccatcgaatattggctgaaa
aaacgttttgccgaagtgccggaagtcgccgccgtgagtgagttcatccacttcgcctgc
accagcgaagacatcaacaacctgtcccacgctttaatgctgcaagaagcgcgtgaggct
gttttgctgccgaagctggccgaaatcatcgaaaaactgaccgctatggcgcacgacctt
gccgccgtcccgatgatgagccgcacccacggccagcccgccacgccgaccactttgggc
aaagaaaccgccaatgtcgtgtaccgcctgcaacgccagtttaaaaacctgcaagcgcaa
gagttcctcggcaaaatcaacggcgcggtcggcaactacaacgcccatatggtcgcctat
cctgatgtagattgggaaacccactgccgcaacttcgtcgaaatcagcctcggtctgacc
ttcaacccctacaccatccaaatcgaaccgcacgactatatggcggaattcttccaaacc
ctcagccgcatcaacacgattctcatcgactttaaccgcgacgtttggggttatatttca
ttgggttacttcaaacaaaaagtcaaagcaggcgaagtcggttcttccaccatgccgcac
aaagtcaaccccatcgactttgaaaactccgagggcaacctcggtatggcaaacgccgta
ttgggctttttgtccgaaaaactgccgatttcccgctggcagcgcgacctgaccgacagc
accgtattgcgcaatatgggcgtaggcgtgggctatgccgtattgggtttcgccgcccac
ctgcgcggtctgaacaagctcgaacccaaccccgccgcgcttgccgccgatttggatgcc
acttgggagctgctcgccgagccgattcaaaccgtaatgcgccgttacggtgtcgccaat
ccttacgaaaaactgaaagacctgacgcgcggcaaaggcggcatcacgcccgaagtgctg
aaaggctttatcggattgctggaaatccccgccgaagccaaagccaaattgcttgagctg
acccccgcgctgtatgtgggcaaggctgaagcgttggcgaaacggatttga

DBGET integrated database retrieval system