KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0317Help
Entry
NMB0317           CDS       T00027                                 

Definition
(RefSeq) 7-cyano-7-deazaguanine reductase
  KO
K09457  7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB0317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB0317
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     NMB0317
Transfer RNA biogenesis [BR:nme03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NMB0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueF QueF_N
Motif
Other DBs
NCBI-GeneID: 902433
NCBI-ProteinID: NP_273366
UniProt: Q9K161
Position
complement(328698..329171)
Genome map
AA seq 157 aa AA seqDB search
MSRNNEELQGISLLGNQKTQYPTGYAPEILEAFDNKHPDNDYFVKFVCPEFTSLCPMTGQ
PDFATIYIRYIPHIKMVESKSLKLYLFSFRNHGDFHEDCVNIIMKDLIALMDPKYIEVFG
EFTPRGGIAIHPFANYGKAGTEFETLARKRLFEHDAQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaacaacgaagagctgcaaggcatctctcttttgggcaatcaaaaaacccaa
tatccgaccggctacgcgcctgaaattctcgaagcattcgacaacaaacatcccgacaac
gactatttcgtcaaattcgtctgtcccgagttcaccagcctctgccccatgaccgggcag
cccgacttcgccaccatctacatccgctacattccgcacatcaaaatggtggaaagcaaa
tccctgaaactctacctcttcagcttccgcaaccacggcgattttcatgaagactgcgtc
aacatcatcatgaaagacctcattgccctgatggatccgaaatacatcgaagtattcggc
gagttcacaccgcgcggcggcatcgccattcatccgtttgccaactacggaaaagcaggc
accgagttcgaaacattggcacgcaaacgcttgtttgagcacgacgcacaataa

DBGET integrated database retrieval system