KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0318Help
Entry
NMB0318           CDS       T00027                                 

Gene name
farA
Definition
(RefSeq) fatty acid efflux system protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0318 (farA)
Transporters [BR:nme02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   NMB0318 (farA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 902434
NCBI-ProteinID: NP_273367
UniProt: Q9K160
Position
329613..330767
Genome map
AA seq 384 aa AA seqDB search
MDTHTDETKLQNTQAKRKRRLTALTLLFALAAAAAGSAFFLWWQHEEETEDAYVAGRVVQ
VTPQKGGTVRKVLHDDTDAVKKGDVLAVLDDDNDVLAYERAKNELVQAVRQNRRQNAATS
QAGAQVALRRADLARAQDDLRRRSALAESGAVSAEELAHARAAVSQAQAAVKAALAEESS
ARAALGGQVSLREQPAVQTAIGRLKDAWLNLQRTQIRAPADGQVAKRSVQVGQQVAAGAP
LMAVVPLSDVWVDANFKETQLRHMKIGQPAELVSDLYGKQIVYRGRVAGFSAGTGSAFSL
IPAQNATGNWIKVVQRVPVRIVLNREDVDRHPLRIGLSMTVKVDTSAAGAPVSKTPGAAL
PEMESTDWSEVDRTVDEILGQSAP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatacgcacacggacgaaacaaaacttcaaaacacgcaagccaaacgcaaacgccgc
ctgacggcattgacgctgctgttcgcgcttgccgccgcagccgccgggtcggcgtttttt
ttatggtggcagcacgaagaggaaacggaagacgcttatgttgccggacgcgtggttcag
gttacgccgcaaaagggcggtacggtgcggaaggttttgcacgacgatacggatgccgtg
aaaaaaggcgacgtgctggcggtattggacgacgataatgatgtgctggcttacgagcgg
gcaaaaaacgagctggttcaggcggtgcggcaaaaccgccggcaaaatgccgccacttcg
caggcgggggcgcaggttgccttgcgccgggcggatttggcacgcgcacaggatgatttg
cgccgccggtctgctttggcggaatcgggcgcggtgtccgccgaagagctggcacacgcc
cgtgcggcagtgtctcaggcgcaggcggcggtcaaagcggctttggcggaagaatcttcg
gcacgtgcggctttgggcggtcaggtttctttgcgcgaacagccggcggttcagacggca
atcggcaggttgaaagatgcgtggttgaaccttcagcggacgcaaatccgcgcgccggcg
gacggtcaggtggcgaagcgttcggtgcaggtcgggcagcaggtggcggcaggcgcgccg
ctgatggcggtggtgccgctgtcggatgtgtgggtggatgctaattttaaagagacgcag
ttgcggcatatgaaaatcggacagcctgccgagctggtgtccgatttgtacggcaaacaa
attgtttatcgcggcagggtggcaggtttttcggcaggtacgggcagcgcgttttcgctg
attccggcgcaaaacgcaacgggcaactggattaaagtggtgcagcgcgtccccgtccgt
atcgtgctgaaccgcgaagatgtggacaggcatccgttgcgtatcggtttgtcgatgacg
gttaaagtggatacttccgccgcaggcgcgcctgtttcaaaaacgccgggtgcggcattg
ccggaaatggaaagtaccgactggtcggaagtcgatcggacggtcgatgaaatcctcggg
caatccgcgccctga

DBGET integrated database retrieval system