KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0323Help
Entry
NMB0323           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_binding_2 NAD_binding_8 Thi4 GIDA HI0933_like DAO FAD_oxidored SE NAD_binding_9 ApbA 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 902439
NCBI-ProteinID: NP_273372
UniProt: Q9K157
Position
complement(333176..334360)
Genome map
AA seq 394 aa AA seqDB search
MSLHSDILVVGAGPAGLSFAAELAGSGLKVTLIERSPLTVLQNPPYDGREIALTHFSREI
MQRLGMWDKIPENEIYPLRDAKVLNGRSDYQLHFPQPTEARGEPADCLGYLISNHNIRRA
AYEVVSQLDNVSILTDTVVKEVKTSDNEAQVILENGKILTARLLLAADSRFSQTRRQLGI
SSDMHDYSRTMFVCRMKHTLSNQHTAYECFHYGRTIALLPLEEHLTNTVITVDTDKINSV
QNLSPEELAASVKEQLKGRLGDMELVSSIHHYPLVGMIAKRFYGKRSALIGDAAVGMHPV
TAHGFNLGLSSADILAKLILEAEQRGQDIGASSLLEKYSSKHMLHAHPLYHGTNMMLKLF
TNETAPAKLLRGLVLRASNNFPPLKKLITKQLTG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacacagcgacatcctcgtcgtcggcgcaggcccggcgggtttaagttttgca
gccgaacttgccggcagcggtttgaaagttaccctgatcgaacgcagcccactgactgtt
ctgcaaaatcctccatatgacggacgcgaaatcgccctgacccatttttcccgcgaaatc
atgcagcgtttgggtatgtgggacaaaattcccgaaaacgaaatctaccctttgcgcgat
gccaaagtgctgaacggacgttccgactaccagctccactttccccaaccgactgaagcg
cgcggcgaacctgccgactgtttgggctatctgatttccaaccacaatatccgccgcgcc
gcctatgaagtcgtatcacaactcgacaatgtcagcattctgaccgatacggttgtcaaa
gaagtcaaaacatctgacaacgaagcacaagtcattttggaaaacggcaaaatactgact
gcacgcctgcttttggcggcagacagccgcttctcgcaaacccgtcgacaactcggtatc
tcctccgatatgcacgattacagccgaaccatgttcgtctgccgtatgaaacataccctt
tccaaccaacataccgcttacgaatgcttccattacggacgcaccatcgcactgctgccg
ctggaagagcacctgaccaataccgtcattaccgtcgataccgataaaatcaacagcgtt
caaaacctttcgcccgaagaattggcggcaagcgtaaaagaacagctcaagggcaggctc
ggcgatatggaattggtcagcagcatccaccattacccccttgtcggcatgattgccaaa
cgtttctacggcaaacgcagcgcgctgattggcgatgccgccgtcggtatgcaccccgtt
acagcacacggtttcaacttggggctttccagcgcagatattttggcaaaactgatactc
gaagccgaacagcgcggtcaagacatcggtgcatcttcattattggaaaaatacagcagc
aaacatatgctgcacgcccatccgctttatcacggaaccaatatgatgctgaaactgttt
accaatgagaccgcaccggcaaaactgttgcgcggcttggtattgcgtgccagcaacaat
ttcccaccgctgaagaaactgatcaccaaacaactgaccggttga

DBGET integrated database retrieval system