KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0326Help
Entry
NMB0326           CDS       T00027                                 

Gene name
ispB
Definition
(RefSeq) octaprenyl-diphosphate synthase
  KO
K02523  octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0326 (ispB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nme01006]
    NMB0326 (ispB)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     NMB0326 (ispB)
Prenyltransferases [BR:nme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMB0326 (ispB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF3486
Motif
Other DBs
NCBI-GeneID: 902442
NCBI-ProteinID: NP_273375
UniProt: Q7DDR3
Position
335528..336502
Genome map
AA seq 324 aa AA seqDB search
MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA
VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR
AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA
AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL
PLIYLMRQGSEQVANDVRTALENADRSYFEKIHDYVVRSDALAYSIGEARKAVDCAVTAL
DALPDSEVKDAMIQLAKESLVRVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagaatctgccctatttccagcgacatctgcctgaagaccttgccaaagtcaat
gaagtcatcaaccgtgcggtgcaatccgatgtcgcactgatttcgcaaatcggtacatat
atcatcagcgcgggcggcaaacgcctgcgtccgattatgacgattttggcgggtaaggcg
gtcggttatgatgacgagaaactgtattcgctggcggcgatggtcgagtttatccacact
tccaccctcctgcacgacgatgtcgtcgatgaaagcgatttgcgccgtgggcgggcaacg
gcaaacaatctgttcggcaatgcggcggctgtgttggttggcgactttttatacacgcgc
gcctttcaactgatggttgcctcgggcagtatgcgcgttttggaagtgatggcggatgca
accaacattattgccgagggcgaagtcatgcagctgatgaacatcggcaatacggacatt
accgaagaacaatatatccaagtcatccaatataaaacggcaaaattgtttgaagctgcc
gctcaagtcggcgcaattttgggcaaggcttcccccgaacacgaacgggcgttgaaagac
tacggtatgtatgtcggtacggcattccaaattattgacgatgtgctggactattctggc
gaaaccgaagaaaccggcaaaaacgtcggcgacgatttggcggaaggaaaaccgactttg
cctttgatttatctgatgcgtcagggttccgaacaggttgcgaacgatgtgcgtactgct
ttggaaaatgcagatcgcagctattttgagaaaatccacgattatgtcgtccgttcggat
gcgttggcatattcgataggcgaggcgcgcaaagcagtcgattgtgccgttaccgccttg
gatgccctgcccgacagcgaagtgaaggatgccatgattcagctggcgaaggaatctttg
gtcagggtgtcttga

DBGET integrated database retrieval system