KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0335Help
Entry
NMB0335           CDS       T00027                                 

Gene name
dapD
Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0335 (dapD)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     NMB0335 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THDPS_N_2 Hexapep_2 Hexapep
Motif
Other DBs
NCBI-GeneID: 902450
NCBI-ProteinID: NP_273384
UniProt: Q9K152
Position
344368..345189
Genome map
AA seq 273 aa AA seqDB search
MSLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAK
KAVLLSFRIQDNEVLNDGVNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAKN
VVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIED
NCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMPS
KDGSHSLYCAVIVKRVDAQTRAKTSVNELLRGI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcaaaacattatcgaaaccgcctttgaaaaccgcgcggacatcaccccgacc
accgttactcccgaagtcaaagaagccgtgttggaaaccatccgccaactcgattccggc
aaactgcgcgttgccgaacgtttgggcgtgggtgagtggaaagtcaacgaatgggcgaaa
aaagccgtgttgctgtccttccgcatccaagacaacgaagtcctcaacgacggcgtgaac
aaatacttcgacaaagtgccgaccaagtttgccgactggtctgaagacgagttcaaaaac
gcaggcttccgcgcagttccgggtgcggttgcccgacgcggcagctttgtggcgaaaaat
gtcgtgctgatgccatcttatgtcaacatcggcgcatacgtcgacgaaggcgcgatggtc
gatacttgggcaaccgtcggctcttgcgcgcaaatcggtaaaaacgtgcacttgagcggg
ggcgtcggcatcggtggtgtactcgaacccctgcaggccgcacccaccatcattgaagac
aactgcttcatcggtgcgcgttctgaaatcgttgagggcgtgattgtcgaagaaggcagc
gtgatttctatgggcgtgttcatcggtcaatccaccaaaatctttgaccgtacaaccggc
gaaatctatcaaggccgcgtaccggcaggttcggttgtcgtatccggcagtatgccttcc
aaagacggcagccacagcctttactgcgccgtcatcgtcaaacgcgtggacgcgcaaacc
cgtgcgaaaaccagcgtcaacgaattgttgcgcggcatctga

DBGET integrated database retrieval system