KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0336Help
Entry
NMB0336           CDS       T00027                                 

Gene name
fabI
Definition
(RefSeq) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme00780  Biotin metabolism
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
nme01212  Fatty acid metabolism
Module
nme_M00083  Fatty acid biosynthesis, elongation
nme_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB0336 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0336 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NMB0336 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nme01004]
    NMB0336 (fabI)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NMB0336 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NMB0336 (fabI)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB0336 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 902451
NCBI-ProteinID: NP_273385
UniProt: Q9K151
Structure
PDB: 

Position
345344..346129
Genome map
AA seq 261 aa AA seqDB search
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgcaaggcaaaaaaattctgattaccggcatgatttccgagcgttccatc
gcttacggcatcgccaaagcctgccgcgaacaaggcgcggaactggcgtttacctacgtt
gtggacaaactggaagagcgcgtccgcaaaatggcggcggaattggattccgaacttgta
ttccgctgcgatgtcgccagcgacgacgaaatcaaccaagtgttcgccgacttgggcaaa
cattgggacggcttggacggtttggtgcattccatcggttttgcgccgaaagaagccttg
agcggcgacttcctcgacagcatcagccgcgaagcgttcaacaccgcacacgaaatttcc
gcatacagcctgcccgcgttggcaaaagccgcccgtccgatgatgcgcggcagaaattcc
gccatcgtcgccctgagctacttgggcgcggtgcgcgcgattccgaattacaacgtgatg
ggtatggcaaaagccagccttgaggcaggcatccgctttaccgctgcctgtctgggtaaa
gagggcatccgctgcaacggtatttccgccggcccgattaaaacgcttgccgcctccggc
atcgccgatttcggcaaactcttgggacacgtcgccgcccacaacccgctccgccgcaac
gttaccattgaagaagtcggcaataccgccgccttcctgctgtccgacctgtcgtccggc
attaccggcgaaatcacttacgttgacggcggttacagcattaatgccttgagcaccgag
ggataa

DBGET integrated database retrieval system