KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0337Help
Entry
NMB0337           CDS       T00027                                 

Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00280  Valine, leucine and isoleucine degradation
nme00290  Valine, leucine and isoleucine biosynthesis
nme00770  Pantothenate and CoA biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nme_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0337
   00280 Valine, leucine and isoleucine degradation
    NMB0337
   00290 Valine, leucine and isoleucine biosynthesis
    NMB0337
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0337
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     NMB0337
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class IV
   NMB0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 902452
NCBI-ProteinID: NP_273386
UniProt: Q9K150
Position
complement(346373..347371)
Genome map
AA seq 332 aa AA seqDB search
MSRPVPAVFGSVFHSQMPVLAYREGKWQPTEWQSSQDLSLAPGAHALHYGSECFEGLKAF
RQADGKIVLFRPTANIARMRQSADILHLPRPETEAYLDALIKLVKRAADEIPDAPAALYL
RPTLIGTDPVIGKAGSPSETALLYILASPVGDYFKVGSPVKILVETEHIRCAPHMGRVKC
GGNYASAMHWVLKAKAEYGANQVLFCPNGDVQETGASNFILINGDEIITKPLTDEFLHGV
TRDSVLTVAKDLGYTVSERNFTVDELKAAVENGAEAILTGTAAVISPVTSFVIGGKEIEV
KSQERGYAIRKAITDIQYGLAEDKYGWLVEVC
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacccgtacccgccgtattcggcagcgtttttcacagtcaaatgcccgtcctc
gcctaccgcgaaggcaaatggcagccgaccgaatggcaatcttcccaagacctctccctc
gcaccgggcgcgcacgccctgcactacggcagcgaatgtttcgagggactgaaagccttc
cgtcaggcagacggcaaaatcgtgctgttccgtccgactgccaatatcgcgcgtatgcgg
caaagtgcggacattttgcacctgccgcgccccgaaaccgaagcttatcttgacgcgcta
atcaaattggtcaaacgtgccgccgatgaaattcccgatgcgcctgccgccctgtacctg
cgtccgaccttaatcggtaccgatcccgttatcggcaaggccggttctccttccgaaacc
gccctgctgtatattttggcttcccccgtcggcgactatttcaaagtcggatcgcccgtc
aaaattttggtggaaaccgaacacatccgctgcgccccgcatatgggccgcgtcaaatgc
ggcggcaactacgcttccgccatgcactgggtgctgaaggcgaaagccgaatatggcgca
aatcaagtcctgttctgcccgaacggcgacgtgcaggaaaccggcgcgtccaactttatc
ctgattaacggcgatgaaatcattaccaaaccgctgaccgacgagtttttgcacggcgta
acccgcgattccgtactgacggttgccaaagatttgggctataccgtcagcgaacgcaat
ttcacggttgacgaactcaaagctgcggtggaaaacggtgcggaagccattttgaccggt
acggcagccgtcatctcgcccgttacttccttcgtcatcggcggcaaagaaatcgaagtg
aaaagccaagaacgcggctatgccatccgtaaggcgattaccgacatccagtatggtttg
gcggaagacaaatacggctggctggttgaagtgtgctga

DBGET integrated database retrieval system