KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0351Help
Entry
NMB0351           CDS       T00027                                 

Gene name
tal
Definition
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nme_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0351 (tal)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     NMB0351 (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 902466
NCBI-ProteinID: NP_273400
UniProt: Q9K139
Position
complement(358919..359974)
Genome map
AA seq 351 aa AA seqDB search
MTILSDVKALGQQIWLDNLSRSLVQSGELAQMLKQGVCGVTSNPAIFQKAFAGDALYADE
IAALKQQNLSPKQRYETMAVADVRAACDVCLAEHESTGGKTGFVSLEVSPELSKDAQGTV
EEARRLYAAIGCKNAMIKVPATDAGIDALETLVSDGISVNLTLLFSRAQTLKAYAAYARG
IAKRLAAGQSVAHIQVVASFFISRVDGALDTTLPDHLKGKIAIALAKAAYQDWAQYFGSP
EFAALETKGANRVQLLWASTGVKNPAYPDTLYVDSLIGAHTVNTVPDATLKAFIDHGTAK
ATLTEGVEEAQAQLAETAALGIDVETLATRLQEDGLKQFEEAFEKLLAPLA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttatcggacgttaaagcattaggacaacaaatctggctggacaacctttcc
cgctcgctagtgcaaagcggcgaattggcgcaaatgttgaaacagggcgtgtgcggcgta
acttccaatcccgccatcttccaaaaagccttcgccggcgacgcgctttacgccgatgaa
atcgccgccctcaagcagcaaaacctcagccccaaacaacgctacgaaacaatggcggtt
gccgatgtgcgtgccgcctgcgacgtttgccttgccgaacacgaatccaccggcggcaaa
accggcttcgtcagcctcgaagtttcgcccgaattgtccaaagacgcgcaaggcacggtt
gaagaagcgcgccgcctctacgccgccatcgggtgcaaaaacgcgatgattaaagtgcct
gccaccgacgcaggcatcgatgcgctcgaaaccctcgtttcagacggcatcagcgtgaac
ctgaccctgctgttctcacgcgcccaaaccctcaaagcctacgccgcctacgcgcgcggc
atcgccaaacgcttagcagccggacaaagcgttgcccatatccaagttgtcgccagcttc
ttcatctcccgtgtggacggcgcgctggacacaacactgcccgaccacctcaaaggcaaa
atcgccatcgcccttgccaaagccgcctaccaagactgggcgcaatacttcggcagcccc
gaatttgccgcgctggaaaccaaaggcgcaaaccgcgtgcagcttttatgggcatctacc
ggcgtgaaaaacccggcctatcccgacacgctctacgttgacagcctgatcggcgcgcac
accgtcaacaccgttcccgatgccacgctcaaagcctttatcgaccacggcacagccaaa
gccacgctgaccgaaggcgtagaagaagcacaagcgcagctcgccgaaaccgccgcgctc
ggcatcgatgtcgaaaccttggcaacgcgtttgcaggaagacggtttgaaacagtttgaa
gaagcgtttgaaaaactgctcgcgcctttggcttag

DBGET integrated database retrieval system